Recombinant Full Length Chlamydia Trachomatis Serovar B Deubiquitinase And Deneddylase Dub1(Cdu1) Protein, His-Tagged
Cat.No. : | RFL18617CF |
Product Overview : | Recombinant Full Length Chlamydia trachomatis serovar B Deubiquitinase and deneddylase Dub1(cdu1) Protein (C4PLJ5) (1-418aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia trachomatis serovar B |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-418) |
Form : | Lyophilized powder |
AA Sequence : | MLSPTNSISKTAPVPPQDSSKPVLISEEPQNQLLQKVARTALAVLLVVVTLGLILLFYSF SDLQSFPWCCQTRPSTKEQPTISIPVPLPSPPLAVPRPSTPPPPVISRPSTPPAPTPAIS PPSTPSAPKPSTPPPLPPKAPKPVKTQEDLLPFVPEQVFVEMYEDMARRRIIEALVPAWD SDIIFKCLCYFHTLYQGLIPLETFPPATIFNFKQKIISILEDKKAVLRGEPIKGSLPICC SEENYRRHLQGTTLLPVFMWYHPTPKTLSDTMQTMKQLAIKGSVGASHWLLVIVDIQARR LVYFDSLYNYVMSPEDMKKDLQSFAQQLDQVYPAYDSQKFSVKIAAKEVIQKGSGSSCGA WCCQFLHWYLRDPFTDALNDLPVDSVERHENLASFVQACEAAVQDLPELFWPEAKALF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cdu1 |
Synonyms | cdu1; CTB_8791; Deubiquitinase and deneddylase Dub1; ChlaDub1 |
UniProt ID | C4PLJ5 |
◆ Recombinant Proteins | ||
CASP4-820H | Recombinant Human CASP4 Protein, His-tagged | +Inquiry |
NGF-2511H | Recombinant Human NGF protein(131-230 aa), N-SUMO & C-His-tagged | +Inquiry |
TAF11-5912R | Recombinant Rat TAF11 Protein | +Inquiry |
gtfB-6744S | Recombinant Streptococcus mutans serotype c (strain ATCC 700610 / UA159) gtfB protein, His-tagged | +Inquiry |
ZC3HAV1-10295M | Recombinant Mouse ZC3HAV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TIMP2-8460H | Native Human TIMP2 | +Inquiry |
PLE-172P | Active Native Porcine Esterase | +Inquiry |
TSH-10B | Active Native Bovine TSH Protein | +Inquiry |
Collagen-58M | Native Mouse Collagen Type II | +Inquiry |
PLD-16C | Active Native cabbage Phospholipase D, Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF385D-82HCL | Recombinant Human ZNF385D 293 Cell Lysate | +Inquiry |
RAD51C-2555HCL | Recombinant Human RAD51C 293 Cell Lysate | +Inquiry |
MLKL-1115HCL | Recombinant Human MLKL cell lysate | +Inquiry |
EGR1-6692HCL | Recombinant Human EGR1 293 Cell Lysate | +Inquiry |
M14-065WCY | Human Melanoma M14 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cdu1 Products
Required fields are marked with *
My Review for All cdu1 Products
Required fields are marked with *
0
Inquiry Basket