Recombinant Full Length Chlamydia Trachomatis Putative Zinc Metalloprotease Ct_072 (Ct_072) Protein, His-Tagged
Cat.No. : | RFL36305CF |
Product Overview : | Recombinant Full Length Chlamydia trachomatis Putative zinc metalloprotease CT_072 (CT_072) Protein (O84075) (1-619aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia Trachomatis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-619) |
Form : | Lyophilized powder |
AA Sequence : | MTIIYFVLAALALGFLILIHELGHLLAAKAVGMSVESFSIGFGPALVRKKMGSVEYRIGA IPFGGYVRIKGMDRNDKDNSGDKEKTVYDIPEGFFSKSPWKRIFVLAAGPLANLLVAIFV FGILYFSGGRTKSFSEYTSIVGWVHPSLEQQGLHAGDQIFFCNGQPYSGHKMAFSSSLLE RKLSLQGQHPAYFSESEAFSLEAPFNPNMEGVPCLGASYLLYRGSDPLPEKSPLVDAGLS EGDRLVWMDGLLVFSGAQVSQMLNEKQSFLRVERQGKVVFVRQARVLAGDLTLTPYFKNE LIDCQYEAGLKGKWASLYTLPYIINGDGFVESKVKLLNDERVSLDYNLELGDKIVAVDGI PVMSNADILRLVQDHRVSLIFQRMSPEQLTVLEQKAADQAFINSYDMDDLLRVAESVGEE REVSRLGDYRLVTRVQPRPWAHIYSEALLDKQRALASKFRDEQERRYYLERIEAEKQRIS LGIPLKDLAVQYNPDPWVLMEESVSDSLKTVKALGMGRVSPQWLSGPVGIVRILHTGWSV GIPEALAWIGLISVNLAVLNLLPIPVLDGGYILLCLWEILSRRRLNMRLVEKALVPFMIL LVLFFVFLTLQDLSRVFVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CT_072 |
Synonyms | CT_072; Putative zinc metalloprotease CT_072 |
UniProt ID | O84075 |
◆ Recombinant Proteins | ||
SurA-2759E | Active Recombinant E.coli SurA, His-tagged | +Inquiry |
RPS28-3840R | Recombinant Rhesus Macaque RPS28 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21871BF | Recombinant Full Length Bovine Transmembrane Protein 100(Tmem100) Protein, His-Tagged | +Inquiry |
UMOD-6542H | Recombinant Human UMOD Protein (Glu334-Ser589), His tagged | +Inquiry |
CCDC169-2763H | Recombinant Human CCDC169 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
IGHG4 -23H | Native Human IgG4 | +Inquiry |
HbA1c-20R | Native Rat Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
LYZ-139C | Native Chicken lysozyme | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTX2-3511HCL | Recombinant Human OTX2 293 Cell Lysate | +Inquiry |
DNAJB6-6884HCL | Recombinant Human DNAJB6 293 Cell Lysate | +Inquiry |
MRPL18-4191HCL | Recombinant Human MRPL18 293 Cell Lysate | +Inquiry |
FIGF-2767HCL | Recombinant Human FIGF cell lysate | +Inquiry |
SPRY2-1490HCL | Recombinant Human SPRY2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CT_072 Products
Required fields are marked with *
My Review for All CT_072 Products
Required fields are marked with *
0
Inquiry Basket