Recombinant Full Length Chlamydia Trachomatis Deubiquitinase And Deneddylase Dub1(Cdu1) Protein, His-Tagged
Cat.No. : | RFL23807CF |
Product Overview : | Recombinant Full Length Chlamydia trachomatis Deubiquitinase and deneddylase Dub1(cdu1) Protein (O84876) (1-418aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia Trachomatis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-418) |
Form : | Lyophilized powder |
AA Sequence : | MLSPTNSTSKKAPVPPQDSSKPVLISEEPQNQLLQKVARTALAVLLVVVTLGLILLFYSF SDLQSFPWCCQTRPSTKEQPTISIPVPLPSPPLAVPRPSTPPPPVISRPSTPPAPTPAIS PPSTPSAPKPSTPPPLPPKAPKPVKTQEDLLPFVPEQVFVEMYEDMARRWIIEALVPAWD SDIIFKCLCYFHTLYQGLIPLETFPPATIFNFKQKIISILEDKKAVLRGEPIKGSLPICC SEENYRRHLHGTTLLPVFMWYHPTPKTLSDTMQTMKQLAIKGSVGASHWLLVIVDIQARR LVYFDSLYNYVMSPEDMEKDLQSFAQQLDQVYPAYDSQKFSVKIAAKEVIQKGSGSSCGA WCCQFLHWYLRDPFTDALNDLPVDSVERHENLASFVQACEAAVQDLPELFWPEAKALF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cdu1 |
Synonyms | cdu1; CT_868; Deubiquitinase and deneddylase Dub1; ChlaDub1 |
UniProt ID | O84876 |
◆ Recombinant Proteins | ||
CHEK1-1186H | Recombinant Human CHEK1 Protein (A2-T476), Tag Free | +Inquiry |
TNFSF10-31604TH | Recombinant Human TNFSF10, FLAG-tagged | +Inquiry |
KRT72-4936M | Recombinant Mouse KRT72 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMKK2-2673M | Recombinant Mouse CAMKK2 Protein | +Inquiry |
COPS5-1889M | Recombinant Mouse COPS5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1851U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 594 labeled | +Inquiry |
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
ATF-177D | Native Dog Apotransferrin | +Inquiry |
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFX-5659HCL | Recombinant Human H2AFX 293 Cell Lysate | +Inquiry |
SIX1-1825HCL | Recombinant Human SIX1 293 Cell Lysate | +Inquiry |
PIP5KL1-3171HCL | Recombinant Human PIP5KL1 293 Cell Lysate | +Inquiry |
LAMP5-8130HCL | Recombinant Human C20orf103 293 Cell Lysate | +Inquiry |
C3orf22-8051HCL | Recombinant Human C3orf22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cdu1 Products
Required fields are marked with *
My Review for All cdu1 Products
Required fields are marked with *
0
Inquiry Basket