Recombinant Full Length Chlamydia Muridarum Phosphatidate Cytidylyltransferase(Cdsa) Protein, His-Tagged
Cat.No. : | RFL24241CF |
Product Overview : | Recombinant Full Length Chlamydia muridarum Phosphatidate cytidylyltransferase(cdsA) Protein (Q9PJU1) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia muridarum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-305) |
Form : | Lyophilized powder |
AA Sequence : | MFDSDKNSILQSDFCQRLVVHSLLLVFLVILLCTSLYPSSAFIVGLLSSTCAAIGTYEMS SMVRMKFPFSFTRYSSIGSAIFVALTCLTARCKMLLPEHVDLIPWFFLFFWTVHLVFKSR HYKLGPIGSTGLALFCMLYVSVPIRLFLHILYGFVHTDTPFIGIWWAIFLIATTKSSDIF GYFFGKAFGKKRIAPVISPNKTVVGFVAGCIASILVSLIFYSHLPKSFANQIAMPWILVA LGIILGISGFFGDIIESTFKRDAQIKNSSDLESIGGMLDVLDSLLLSTPIVYAILLITQN GTFLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cdsA |
Synonyms | cdsA; TC_0736; Phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase |
UniProt ID | Q9PJU1 |
◆ Recombinant Proteins | ||
NI36-RS03125-0714S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS03125 protein, His-tagged | +Inquiry |
AKR1B3-1492M | Recombinant Mouse AKR1B3 Protein | +Inquiry |
EEF1A1-4205HF | Recombinant Full Length Human EEF1A1 Protein, GST-tagged | +Inquiry |
MYL3-8027H | Recombinant Human MYL3 protein, His-tagged | +Inquiry |
MPXV-0657 | Recombinant Monkeypox Virus O2L Protein | +Inquiry |
◆ Native Proteins | ||
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
IgG-01H | Native Human Immunoglobulin G | +Inquiry |
CTSH-27404TH | Native Human CTSH | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMP4-5215HCL | Recombinant Human IMP4 293 Cell Lysate | +Inquiry |
SPATA7-1531HCL | Recombinant Human SPATA7 293 Cell Lysate | +Inquiry |
SERBP1-1950HCL | Recombinant Human SERBP1 293 Cell Lysate | +Inquiry |
HSPA2-5355HCL | Recombinant Human HSPA2 293 Cell Lysate | +Inquiry |
SULT1A4-1353HCL | Recombinant Human SULT1A4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cdsA Products
Required fields are marked with *
My Review for All cdsA Products
Required fields are marked with *
0
Inquiry Basket