Recombinant Full Length Chicken Transmembrane Protein 194B(Tmem194B) Protein, His-Tagged
Cat.No. : | RFL12232GF |
Product Overview : | Recombinant Full Length Chicken Transmembrane protein 194B(TMEM194B) Protein (Q5ZJY9) (1-447aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-447) |
Form : | Lyophilized powder |
AA Sequence : | MGPRRLPWARPGPALGLLLLALAGAVPAAGGSCSLLEEGNTIQKLHEDCFCYVQNRTMHL QYIWSTVQVKINSTRTFRFVPTPEKSNCRNSETVFEFAACAVQILWRPETSTETFLKIKQ YGEDFCFRIQPFKEELYTVSMTREMLDGKLLFLFAAGIFLFHFANSLSRSTNFFYLSGII LGVLALLVFVLLALKRFIPRRSTFWILLSGCWMSSLYLIYCFKENMQWLWSEHRIYVLGY FVAVGTLSFATCYQHGPLTSELSITLFTWTLQLTAFVFIYCGVNIPQVAYAIIAVKPSPK GLGYPPAAAWHIGRKMKNHFQSKKVVVRCLTEEEYREQGETETVRALEELRSFCKNPDFS SWLAVSKLQSPHRFAGFVLGSPHVSPAETKAHDEEYGIGSSFLEEQLFETRTESEQDETT SYIHEGDDENEDEIHEPISFPYATELL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NEMP2 |
Synonyms | NEMP2; TMEM194B; RCJMB04_14f14; Nuclear envelope integral membrane protein 2 |
UniProt ID | Q5ZJY9 |
◆ Recombinant Proteins | ||
MYO5A-3525R | Recombinant Rat MYO5A Protein, His (Fc)-Avi-tagged | +Inquiry |
CLMP-5663H | Recombinant Human CLMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM58A-1444R | Recombinant Rhesus Macaque FAM58A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL29834PF | Recombinant Full Length Pinus Sylvestris Chlorophyll A-B Binding Protein Type 2 Member 1B, Chloroplastic Protein, His-Tagged | +Inquiry |
C17orf103-15877H | Recombinant Human C17orf103, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH2-8340H | Native Human LDH2 | +Inquiry |
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
LDH5-225H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
PRC1-5267P | Active Native Yeast PRC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGER-1480HCL | Recombinant Human AGER cell lysate | +Inquiry |
SDF2-729HCL | Recombinant Human SDF2 cell lysate | +Inquiry |
USP12-473HCL | Recombinant Human USP12 293 Cell Lysate | +Inquiry |
C3orf67-8039HCL | Recombinant Human C3orf67 293 Cell Lysate | +Inquiry |
Peripheral-17H | Human Peripheral blood leukocyte lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEMP2 Products
Required fields are marked with *
My Review for All NEMP2 Products
Required fields are marked with *
0
Inquiry Basket