Recombinant Full Length Chicken Transmembrane Anterior Posterior Transformation Protein 1 Homolog(Tapt1) Protein, His-Tagged
Cat.No. : | RFL21715GF |
Product Overview : | Recombinant Full Length Chicken Transmembrane anterior posterior transformation protein 1 homolog(TAPT1) Protein (Q5ZLG8) (1-581aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-581) |
Form : | Lyophilized powder |
AA Sequence : | MAGVSDAAAPGSGGEGRRGGGGSPEQLQQDGCRGEPKTLWGSSELRPPPAGPGQPSPHQR TETLGFYESDRGRKKKRGLSDLSLLRFISAELTRGYFLEHNEAKYTERRERVYTCMRIPK ELEKLMFFGIFLCLDAFLYIFTLLPLRVFLAMFRFITLPCYGLRDRRLLQPAQVCDILKG VILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTAT EPKERKRAHIGVIPHFFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEI KGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVV ASEIAVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVSRRMGFIP LPLAVLLMRVVTSSIKVQGVLAYVCVVLFYCGLISLKVLNSIVLLGKSCQYVKEAKMEEK LFNPVPSASAGKPAGKPQSMFKSTHGFSTDENGSTSVTNQPVHQKDSPPSLLVTSNSDQF LTTPDGEEKDISQDSSELKHRSSKKDLLEIDRFTICGNRID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TAPT1 |
Synonyms | TAPT1; RCJMB04_6d24; Transmembrane anterior posterior transformation protein 1 homolog |
UniProt ID | Q5ZLG8 |
◆ Native Proteins | ||
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
ACTA1-157R | Native Rabbit skeletal muscle alpha Actin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS3-909HCL | Recombinant Human TMPRSS3 293 Cell Lysate | +Inquiry |
Fetal Parietal Lobe -155H | Human Fetal Parietal Lobe Lysate | +Inquiry |
MRRF-4130HCL | Recombinant Human MRRF 293 Cell Lysate | +Inquiry |
Kidney-843P | Pig Kidney Membrane Lysate, Total Protein | +Inquiry |
Spinal cord-459H | Human Spinal cord Liver Cirrhosis Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TAPT1 Products
Required fields are marked with *
My Review for All TAPT1 Products
Required fields are marked with *
0
Inquiry Basket