Recombinant Full Length Chicken Thyrotropin-Releasing Hormone Receptor(Trhr) Protein, His-Tagged
Cat.No. : | RFL34839GF |
Product Overview : | Recombinant Full Length Chicken Thyrotropin-releasing hormone receptor(TRHR) Protein (O93603) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MENGTGDEQNHTGLLLSSQEFVTAEYQVVTILLVLLICGLGIVGNIMVVLVVLRTKHMRT PTNCYLVSLAVADLMVLVAAGLPNITESLYKSWVYGYVGCLCITYLQYLGINASSFSITA FTIERYIAICHPIKAQFLCTFSRAKKIIIFVWSFASVYCMLWFFLLDLNIAVYKDTTVVS CGYKVSRSYYSPIYMMDFGIFYVLPMVLATVLYGLIARILFLNPIPSDPKENSNTWKNDM AQQNKTVNSKMTNKSFNSTIASRRQVTKMLAVVVVLFAFLWMPYRTLVVVNSFLSSPFQE NWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCHLKRDKKPANYSVALNYNVIK ESDHFSSEIEDITVTNTYLSSAKTSIGDTCLSSEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TRHR |
Synonyms | TRHR; Thyrotropin-releasing hormone receptor; TRH-R; Thyroliberin receptor |
UniProt ID | O93603 |
◆ Recombinant Proteins | ||
GRHL2B-5377Z | Recombinant Zebrafish GRHL2B | +Inquiry |
RFL18488BF | Recombinant Full Length Bacillus Cereus Potassium-Transporting Atpase C Chain(Kdpc) Protein, His-Tagged | +Inquiry |
MFI2-946M | Recombinant Mouse MFI2 Protein, His-tagged | +Inquiry |
KIAA1804-354H | Recombinant Human KIAA1804, His-tagged | +Inquiry |
PCK2-12403Z | Recombinant Zebrafish PCK2 | +Inquiry |
◆ Native Proteins | ||
Ferritin-12H | Native Human Ferritin Protein, Tag Free | +Inquiry |
CAT-21H | Native Human Catalase Protein | +Inquiry |
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC23-7667HCL | Recombinant Human CDC23 293 Cell Lysate | +Inquiry |
PEG10-3306HCL | Recombinant Human PEG10 293 Cell Lysate | +Inquiry |
NMB-3795HCL | Recombinant Human NMB 293 Cell Lysate | +Inquiry |
STYXL1-1369HCL | Recombinant Human STYXL1 293 Cell Lysate | +Inquiry |
Colon-93H | Human Colon Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TRHR Products
Required fields are marked with *
My Review for All TRHR Products
Required fields are marked with *
0
Inquiry Basket