Recombinant Full Length Chicken Red-Sensitive Opsin Protein, His-Tagged
Cat.No. : | RFL6532GF |
Product Overview : | Recombinant Full Length Chicken Red-sensitive opsin Protein (P22329) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MAAWEAAFAARRRHEEEDTTRDSVFTYTNSNNTRGPFEGPNYHIAPRWVYNLTSVWMIFV VAASVFTNGLVLVATWKFKKLRHPLNWILVNLAVADLGETVIASTISVINQISGYFILGH PMCVVEGYTVSACGITALWSLAIISWERWFVVCKPFGNIKFDGKLAVAGILFSWLWSCAW TAPPIFGWSRYWPHGLKTSCGPDVFSGSSDPGVQSYMVVLMVTCCFFPLAIIILCYLQVW LAIRAVAAQQKESESTQKAEKEVSRMVVVMIVAYCFCWGPYTFFACFAAANPGYAFHPLA AALPAYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDGSEVSTSRTEVSSVSNSSVS PA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Red-sensitive opsin |
Synonyms | Red-sensitive opsin; Iodopsin; Red cone photoreceptor pigment |
UniProt ID | P22329 |
◆ Recombinant Proteins | ||
SOWAHD-15770M | Recombinant Mouse SOWAHD Protein | +Inquiry |
CD70-515H | Recombinant Human CD70 Protein (Gln39-Pro193), N-mFc and C-6×His-tagged | +Inquiry |
RFL32056SF | Recombinant Full Length Saccharomyces Cerevisiae Protein Translocation Protein Sec63(Sec63) Protein, His-Tagged | +Inquiry |
Casp3-623M | Recombinant Mouse Casp3 protein, His-tagged | +Inquiry |
Cd27-643R | Active Recombinant Rat Cd27, Fc Chimera | +Inquiry |
◆ Native Proteins | ||
IgA-3882M | Native Monkey Immunoglobulin A, Tag Free | +Inquiry |
IgG-166R | Native Rat IgG Fc fragment | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
LDL-245H | Native Human Lipoproteins, Low Density | +Inquiry |
Collagen type I-03H | Native Human Collagen type I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAD-8529HCL | Recombinant Human BAD 293 Cell Lysate | +Inquiry |
HCT-116-032HCL | Human HCT-116 Whole Cell Lysate | +Inquiry |
Pancreas-42H | Human Pancreas Tumor Tissue Lysate | +Inquiry |
ARL13B-8720HCL | Recombinant Human ARL13B 293 Cell Lysate | +Inquiry |
KLKB1-4899HCL | Recombinant Human KLKB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Red-sensitive opsin Products
Required fields are marked with *
My Review for All Red-sensitive opsin Products
Required fields are marked with *
0
Inquiry Basket