Recombinant Full Length Chicken Olfactory Receptor-Like Protein Cor1(Cor1) Protein, His-Tagged
Cat.No. : | RFL10819GF |
Product Overview : | Recombinant Full Length Chicken Olfactory receptor-like protein COR1(COR1) Protein (P37067) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIALISVDLHLQTPMY IFLQNLSFTDAAYSTVITPKMLATFLEERKTISYVGCILQYFSFVLLTVTESLLLAVMAY DRYVAICKPLLYPSIMTKAVCWRLVESLYFLAFLNSLVHTSGLLKLSFCYSNVVNHFFCD ISPLFQISSSSIAISELLVIISGSLFVMSSIIIILISYVFIILTVVMIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDA LRRLTATTFGFIDSKAVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COR1 |
Synonyms | COR1; Olfactory receptor-like protein COR1 |
UniProt ID | P37067 |
◆ Recombinant Proteins | ||
FAM111B-3675H | Recombinant Human FAM111B Protein, GST-tagged | +Inquiry |
ROCG-0065B | Recombinant Bacillus subtilis ROCG protein, His-tagged | +Inquiry |
FAM24B-4667H | Recombinant Human FAM24B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTX1-7968H | Recombinant Human MTX1 protein, His & T7-tagged | +Inquiry |
MRGPRB5-5675M | Recombinant Mouse MRGPRB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
E2-01H | Native Human Estradiol (E2) | +Inquiry |
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
SERPINC1-26143TH | Native Human SERPINC1 | +Inquiry |
IgA-7431M | Native Mouse Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFG-1124HCL | Recombinant Human TFG 293 Cell Lysate | +Inquiry |
FUT10-2490HCL | Recombinant Human FUT10 cell lysate | +Inquiry |
SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry |
AP2M1-8813HCL | Recombinant Human AP2M1 293 Cell Lysate | +Inquiry |
RAB21-2620HCL | Recombinant Human RAB21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COR1 Products
Required fields are marked with *
My Review for All COR1 Products
Required fields are marked with *
0
Inquiry Basket