Recombinant Full Length Chicken Melatonin Receptor Type 1A Protein, His-Tagged
Cat.No. : | RFL15051GF |
Product Overview : | Recombinant Full Length Chicken Melatonin receptor type 1A Protein (P49285) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MRANGSELNGTVLPRDPPAEGSPRRPPWVTSTLATILIFTIVVDLLGNLLVILSVYRNKK LRNAGNIFVVSLAIADLVVAIYPYPLVLTSVFHNGWNLGYLHCQISGFLMGLSVIGSIFN ITGIAINRYCYICHSLKYDKLYSDKNSLCYVGLIWVLTVVAIVPNLFVGSLQYDPRIYSC TFAQSVSSAYTIAVVFFHFILPIAIVTYCYLRIWILVIQVRRRVKPDNNPRLKPHDFRNF VTMFVVFVLFAVCWAPLNFIGLAVAVDPETIIPRIPEWLFVSSYYMAYFNSCLNAIIYGL LNQNFRREYKKIVVSFCTAKAFFQDSSNDAADRIRSKPSPLITNNNQVKVDSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Melatonin receptor type 1A |
Synonyms | Melatonin receptor type 1A; Mel-1A-R; Mel1a receptor; CKA |
UniProt ID | P49285 |
◆ Recombinant Proteins | ||
C1QB-1132M | Recombinant Mouse C1QB Protein, His (Fc)-Avi-tagged | +Inquiry |
SUO-0008P2-2376S | Recombinant Staphylococcus aureus (strain: 19321) SUO_0008P2 protein, His-tagged | +Inquiry |
RFL2453LF | Recombinant Full Length Lysinibacillus Sphaericus Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged | +Inquiry |
SH3BP4-15068M | Recombinant Mouse SH3BP4 Protein | +Inquiry |
SULT1C3-6169C | Recombinant Chicken SULT1C3 | +Inquiry |
◆ Native Proteins | ||
Ferritin-180M | Native Mouse Ferritin | +Inquiry |
Lectin-1838S | Active Native Sambucus Nigra Lectin Protein, Biotinylated | +Inquiry |
Bcl2a1b-5322M | Native Mouse B-Cell Leukemia/Lymphoma 2 Related Protein A1b | +Inquiry |
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
Adipose Tissue-001H | Human Adipose Tissue Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Epididymus-116R | Rhesus monkey Epididymus Lysate | +Inquiry |
CACFD1-7926HCL | Recombinant Human C9orf7 293 Cell Lysate | +Inquiry |
MYL7-4021HCL | Recombinant Human MYL7 293 Cell Lysate | +Inquiry |
GPR176-744HCL | Recombinant Human GPR176 cell lysate | +Inquiry |
FAM71A-6356HCL | Recombinant Human FAM71A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Melatonin receptor type 1A Products
Required fields are marked with *
My Review for All Melatonin receptor type 1A Products
Required fields are marked with *
0
Inquiry Basket