Recombinant Full Length Chicken Cyclic Nucleotide-Gated Channel Cone Photoreceptor Subunit Alpha Protein, His-Tagged
Cat.No. : | RFL14170GF |
Product Overview : | Recombinant Full Length Chicken Cyclic nucleotide-gated channel cone photoreceptor subunit alpha Protein (Q90805) (1-735aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-735) |
Form : | Lyophilized powder |
AA Sequence : | MAKINTQHSYPGMHGLSVRTTDEDIERIENGFIRTHSLCEDTSSELQRVISMEGRHLSGS QTSPFTGRGAMARLSRFVVSLRSWATRHLHHEDQRPDSFLERIRGPELVEVSSRQSNIRS FLGIREQPGGVNGPWPLARFNVNFSNNTNEDKKEEKKEVKEEKKEEKKEEKKEEKKDDKK DDKKDDKKDDKKKEEQKKEVFVIDPSSNMYYNWLTIIAAPVFYNWCMLICRACFDELQID HIKLWLFLDYCSDIIYVFDMFVRFRTGFLEQGLLVKDEKKLRDHYTQTVQFKLDVLSLLP TDLAYLKLGLNYPELRFNRLLRIARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNA CIYFAISKVIGFGTDSWVYPNVSIPEYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEY LFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKVDSIKQYMHFRKVTKDLEARVI KWFDYLWTNKKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKL KPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGS KSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEEAAK AGADPKDLEEKIDRLETALDTLQTRFARLLAEYSSSQQKVKQRLARVETRVKKYGSGSLS VGEPEPEKPEEQKKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cyclic nucleotide-gated channel cone photoreceptor subunit alpha |
Synonyms | Cyclic nucleotide-gated channel cone photoreceptor subunit alpha; CNG channel 1; CNG-1; CNG1 |
UniProt ID | Q90805 |
◆ Recombinant Proteins | ||
MLLT11-5585M | Recombinant Mouse MLLT11 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPS1-309C | Recombinant Cynomolgus Monkey GPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL6326DF | Recombinant Full Length Dumortiera Hirsuta Photosystem Q(B) Protein(Psba) Protein, His-Tagged | +Inquiry |
CDK5/CDK5R1-1653H | Recombinant Human CDK5/CDK5R1 Protein (M1-P292/G2-R307), GST/Flag/His-tagged | +Inquiry |
KCNJ10-3195R | Recombinant Rat KCNJ10 Protein | +Inquiry |
◆ Native Proteins | ||
Tnnt3-7424M | Native Mouse Tnnt3 Protein | +Inquiry |
MUC1-376H | Active Native Human MUC1 | +Inquiry |
Proteasome 19S-39H | Native Human Proteasome 19S Protein, Tag Free | +Inquiry |
SERPINA3-27285TH | Native Human SERPINA3 | +Inquiry |
F2-73R | Native Rat Prothrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR25-735HCL | Recombinant Human WDR25 lysate | +Inquiry |
CXorf48-429HCL | Recombinant Human CXorf48 cell lysate | +Inquiry |
C3orf1-8056HCL | Recombinant Human C3orf1 293 Cell Lysate | +Inquiry |
AMIGO1-8882HCL | Recombinant Human AMIGO1 293 Cell Lysate | +Inquiry |
UPK1A-723HCL | Recombinant Human UPK1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cyclic nucleotide-gated channel cone photoreceptor subunit alpha Products
Required fields are marked with *
My Review for All Cyclic nucleotide-gated channel cone photoreceptor subunit alpha Products
Required fields are marked with *
0
Inquiry Basket