Recombinant Full Length Cherry Rasp Leaf Virus Rna1 Polyprotein Protein, His-Tagged
Cat.No. : | RFL7456CF |
Product Overview : | Recombinant Full Length Cherry rasp leaf virus RNA1 polyprotein Protein (Q6EWG9) (1544-2250aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cherry rasp leaf virus (isolate Potato/United States) (CRLV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (1544-2250) |
Form : | Lyophilized powder |
AA Sequence : | GPEEMYIPTKNSECFGSVTKLGAWTGPKPYFLEKTSLIPSLISTSIDVERTTEPAILSQR DKRLKDSINPEFDVFLEGMKKYAVEAHSLDEDLEVFEDALDRVFLEIPEHACEDLTNDQV CNGIEDDPYAEGIVMQTAEGFPFCTQRPAGASGKSWLFAGAPGDWHIVPGSLLANEMHKK EVAPSRGLFEPLIGIDFPKDEKVDSSKVYIKPKTRLFTILPVDYNILVRKYFLSSVSHIM TQHNTIPVKVGIDCLSNEWSILYHQLRSKGTNWFNGDYSRFDGITPRNVLQGIVKRINKF YNNKNSLAITDSNLSINSDLARSLLTDMASTRYGLTNGDLWYVTSGIPSGFPLTVIVNSL VNNFFIHFSYIKLMKREELNSLYPLHSFRQMVAYATYGDDNLVSVNDVITEKFNLVKIAD LLAEHGVTLKNGADKNEEILSPFYPLEKVDFLKRKFVHYQGHVVAPLNPVNITERLHWIR KGLGEADATLENCSSAAFEALFHGRCYYDTLVAKIYKACAASKLSIQLPTYNDALAIFLS NDSFAKAIQTISLDLPKAIFVNKSNYFVSEIFPDVFFCSNERNVTLHKLLEITTTRNICY ISRNYESRNSSRGLFSLKGEGWALAPVSARLVVYKNMQKPVYFVDEANDGLALAYCLDYM LRIKGVSRSRLAQVLYNIFGHDETLCSRIASNFSLLDSNKYMPPHKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cherry rasp leaf virus RNA1 polyprotein |
Synonyms | RNA1 polyprotein; Genome polyprotein B; P1 |
UniProt ID | Q6EWG9 |
◆ Recombinant Proteins | ||
METTL21A-2743R | Recombinant Rhesus monkey METTL21A Protein, His-tagged | +Inquiry |
TSSK2-5537H | Recombinant Human TSSK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Col6a2-918M | Recombinant Mouse Col6a2 Protein, MYC/DDK-tagged | +Inquiry |
RAI2-7403M | Recombinant Mouse RAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS2-2443H | Recombinant Human RRAS2, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-06M | Native Mouse Collagen Type I and III Protein | +Inquiry |
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
ALB-524H | Native Human ALB protein | +Inquiry |
Dimer-110H | Native Human D-Dimer Protein | +Inquiry |
AZU1-26565TH | Native Human AZU1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIRA-791HCL | Recombinant Human HIRA cell lysate | +Inquiry |
SGTB-1881HCL | Recombinant Human SGTB 293 Cell Lysate | +Inquiry |
EPN3-6579HCL | Recombinant Human EPN3 293 Cell Lysate | +Inquiry |
STXBP1-624HCL | Recombinant Human STXBP1 cell lysate | +Inquiry |
KLHDC2-4922HCL | Recombinant Human KLHDC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cherry rasp leaf virus RNA1 polyprotein Products
Required fields are marked with *
My Review for All Cherry rasp leaf virus RNA1 polyprotein Products
Required fields are marked with *
0
Inquiry Basket