Recombinant Full Length Chara Vulgaris Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged
Cat.No. : | RFL31953CF |
Product Overview : | Recombinant Full Length Chara vulgaris Cytochrome b559 subunit alpha(psbE) Protein (Q1ACI7) (1-83aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chara vulgaris (Common stonewort) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-83) |
Form : | Lyophilized powder |
AA Sequence : | MSGNTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFTENR QEVPLITDRFNSLEQIESYTKSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbE |
Synonyms | psbE; Cytochrome b559 subunit alpha; PSII reaction center subunit V |
UniProt ID | Q1ACI7 |
◆ Recombinant Proteins | ||
MCAM-378H | Recombinant Human MCAM Protein, His-tagged | +Inquiry |
HS6ST2-9771Z | Recombinant Zebrafish HS6ST2 | +Inquiry |
PEPD-22H | Recombinant Human PEPD Protein, His-tagged | +Inquiry |
SIAE-3872Z | Recombinant Zebrafish SIAE | +Inquiry |
BRCA1-1010R | Recombinant Rat BRCA1 Protein | +Inquiry |
◆ Native Proteins | ||
Chitosan-004C | Native Crawfish Chitosan Film | +Inquiry |
IgY-005C | Native Chicken IgY Ig Fraction | +Inquiry |
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
CA6-804H | Native Human CA6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT1-1168HCL | Recombinant Human NAT1 cell lysate | +Inquiry |
REG1B-2449HCL | Recombinant Human REG1B cell lysate | +Inquiry |
CAMK2N1-7875HCL | Recombinant Human CAMK2N1 293 Cell Lysate | +Inquiry |
MPST-4224HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
NELL2-468HCL | Recombinant Human NELL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbE Products
Required fields are marked with *
My Review for All psbE Products
Required fields are marked with *
0
Inquiry Basket