Recombinant Full Length Chaetomium Globosum Probable Lysosomal Cobalamin Transporter(Chgg_01714) Protein, His-Tagged
Cat.No. : | RFL6643CF |
Product Overview : | Recombinant Full Length Chaetomium globosum Probable lysosomal cobalamin transporter(CHGG_01714) Protein (Q2HDJ0) (1-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chaetomium globosum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-646) |
Form : | Lyophilized powder |
AA Sequence : | MAPAGLLQTSLIWVAYGVAVALVLLVSVITTLTWQTPHERSIAVSIVSIISLTALLATVF LLPVDIALVSSTASAHLGAKKDWATPGRVDGILLTLKIVYYTLYTLDALLCLIVIPFTYF WFEEYDEVEEEEGTSSAAARIWRALKYTLGFVFLVVILFLIGFFVPAAGNNPGKHMDLDY FKRLLAANNGEKALTFGVGLLITLGTLLYILYTSAGLALLPVSFIKSAPSISAPQLSATT ASALEHNRELQRQLEMRNSGRPEGMSQKDRREMDALLREERTLVRRERLAAEARGDNRSK IYRAWTKVEAVFRPLKLLGGIFLLLLAILIWVSMLITGIDKAANSICKQHCGYILGHLNV FQPINWIFVQSAKAFPVDYILMALLVLLFFSSSITGLATIGIRFLWVRIFQLKKGRTAPQ ALLIATVLLGPHDPRHQLRGRHARGAAVRHLRHADLLRQPAAATRASSPTAASTATWCAP APRPSASPAAIGRLHADRHVHLPQPRPPSNWPRLRRPSTSGPSSSSSPSSSSSSSPASSR TPRLNLSELDEEAEVDERGGPAGPAPAAALARPGAISPAAPRRTPPRRARRVMARRLGTR MGVGRARGVKLNGGAATENDKKEKKNGTWVWAWVWEWEWQTDWLAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CHGG_01714 |
Synonyms | CHGG_01714; Probable lysosomal cobalamin transporter |
UniProt ID | Q2HDJ0 |
◆ Recombinant Proteins | ||
HLA-A&B2M-1569H | Recombinant Human HLA-A&B2M protein, His-Avi-tagged, Biotinylated | +Inquiry |
RFL32962GF | Recombinant Full Length Geobacter Sulfurreducens Nadh-Quinone Oxidoreductase Subunit K 2(Nuok2) Protein, His-Tagged | +Inquiry |
YODB-0503B | Recombinant Bacillus subtilis YODB protein, His-tagged | +Inquiry |
MCOLN1-784H | Recombinant Human MCOLN1, His-tagged | +Inquiry |
CYP2U1-4203M | Recombinant Mouse CYP2U1 Protein | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
PLAT-30920TH | Native Human PLAT | +Inquiry |
Hemocyanin-031H | Native Helix pomatia Hemocyanin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RXRG-2097HCL | Recombinant Human RXRG 293 Cell Lysate | +Inquiry |
C18orf56-8218HCL | Recombinant Human C18orf56 293 Cell Lysate | +Inquiry |
SLC25A12-1783HCL | Recombinant Human SLC25A12 293 Cell Lysate | +Inquiry |
CALM3-7888HCL | Recombinant Human CALM3 293 Cell Lysate | +Inquiry |
CLEC7A-2455MCL | Recombinant Mouse CLEC7A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHGG_01714 Products
Required fields are marked with *
My Review for All CHGG_01714 Products
Required fields are marked with *
0
Inquiry Basket