Recombinant Full Length Cellvibrio Japonicus Upf0761 Membrane Protein Cja_2282 (Cja_2282) Protein, His-Tagged
Cat.No. : | RFL8966CF |
Product Overview : | Recombinant Full Length Cellvibrio japonicus UPF0761 membrane protein CJA_2282 (CJA_2282) Protein (B3PJS2) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cellvibrio japonicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MALSTPVTDFKQGFLQQLNWLKGFLYLIVQQYQAKACQKSAASLTYMTLFATVPMMTVTY AMFSIIPAFQHLGDQLQNLIFTHVLPNNEQDISRYLKNFSAQARQLTWLGGVFLVVSAYL MLKNIEKNFNAIWGVAQGRRGIANFLLYWAILSLGPLLLGVALAMSTYLTSFRLLVGSYD SLGVLELVFQYVPWLLNWAAFTLLFVAVPNCKVPTRHALVGGLLTTIAFQALKAIFAWIV SHSSFTLVYGAFAALPLFLLWVNMTWMVILGGAVFVHSIKFYQIGLRDRAYPDVFASLLV IWHLHQASLRGQSMSEWQILLLGLSTQQWQRLSKRLLGRHVIAQTQQGDFVLCYDLSLLT LSTLAEWIGQRPDWPGVDELTRELPWGQASEQVLGAVDNARAQSWDLTLSAFFAVNQALD NAPPLAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CJA_2282 |
Synonyms | CJA_2282; UPF0761 membrane protein CJA_2282 |
UniProt ID | B3PJS2 |
◆ Recombinant Proteins | ||
REEP5-10412Z | Recombinant Zebrafish REEP5 | +Inquiry |
CYP1D1-963R | Recombinant Rhesus Macaque CYP1D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGFR-102MAF555 | Recombinant Mouse Egfr Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
NKX3-2-3038R | Recombinant Rhesus monkey NKX3-2 Protein, His-tagged | +Inquiry |
CASP3-188H | Recombinant Human CASP3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
CAPN2-22P | Active Native Porcine CAPN2 protein | +Inquiry |
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
TTR-131H | Native Human Prealbumin protein | +Inquiry |
DPP4-31H | Active Native Human DPP4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100Z-2085HCL | Recombinant Human S100Z 293 Cell Lysate | +Inquiry |
WIF1-1525MCL | Recombinant Mouse WIF1 cell lysate | +Inquiry |
ALDH5A1-60HCL | Recombinant Human ALDH5A1 cell lysate | +Inquiry |
INPP5K-5197HCL | Recombinant Human INPP5K 293 Cell Lysate | +Inquiry |
ACBD6-688HCL | Recombinant Human ACBD6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CJA_2282 Products
Required fields are marked with *
My Review for All CJA_2282 Products
Required fields are marked with *
0
Inquiry Basket