Recombinant Full Length Cell Invasion Protein Sipb(Sipb) Protein, His-Tagged
Cat.No. : | RFL25057SF |
Product Overview : | Recombinant Full Length Cell invasion protein sipB(sipB) Protein (Q56134) (1-593aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-593) |
Form : | Lyophilized powder |
AA Sequence : | MVNDASSISRSGYTQNPRLAEAAFEGVRKNTDFLKAADKAFKDVVATKAGDLKAGTKSGE SAINTVGLKPPTDAAREKLSSEGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKE MGIQVSKEFQTALGEAQEATDLYEASIKKTDTAKSVYDAAAKKLTQAQNKLQSLDPADPG YAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNILTKFQGTANAASQN QVSQGEQDNLSNVARLTMLMAMFIEIVGKNTEESLQNDLALFNALQEGRQAEMEKKSAEF QEETRKAEETNRIMGCIGKVLGALLTIVSVVAAVFTGGASLALAAVGLAVMVADEIVKAA TGVSFIQQALNPIMEHVLKPLMELIGKAITKALEGLGVDKKTAEMAGSIVGAIVAAIAMV AVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVLKQLAQNGSKLFTQGMQRITSGLG NVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAAQSAGGVAEGVFIKNASEALADFML ARFAMDQIQQWLKQSVEIFGENQKVTAELQKAMSSAVQQNADASRFILRQSRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sipB |
Synonyms | sipB; STY3008; t2787; Cell invasion protein SipB; Effector protein SipB |
UniProt ID | Q56134 |
◆ Native Proteins | ||
F10-290M | Active Native Mouse Factor X | +Inquiry |
TF-136C | Native Chicken Ovotransferrin | +Inquiry |
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
FG-116H | Native Human Fibrinogen | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPLX4-7311HCL | Recombinant Human CPLX4 293 Cell Lysate | +Inquiry |
RCN3-1282HCL | Recombinant Human RCN3 cell lysate | +Inquiry |
Rectum-54H | Human Rectum Tumor Tissue Lysate | +Inquiry |
CDC5L-7648HCL | Recombinant Human CDC5L 293 Cell Lysate | +Inquiry |
HeLa-025HCL | Human Etoposide Stimulated HeLa Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All sipB Products
Required fields are marked with *
My Review for All sipB Products
Required fields are marked with *
0
Inquiry Basket