Recombinant Full Length Cell Division Protein Ftsx Homolog(Ftsx) Protein, His-Tagged
Cat.No. : | RFL18304NF |
Product Overview : | Recombinant Full Length Cell division protein FtsX homolog(ftsX) Protein (P95357) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria gonorrhoeae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-305) |
Form : | Lyophilized powder |
AA Sequence : | MSIIHYFSLHVESARSALKQLLRQPFGTLLTLIMLAVAMTLPLFMYLGIQSGQSVLGKLN ESPQITVYMETAAAQSDSDTVRSLLTRDKRLDNIRFIGKEDGLAELQSNLDQNLISMLDG NPLPDVFIVTPDPATTPAQMQAIYRDITKLPMVESASMDTEWVQTLYQINEFIRKILWFL SLTLGMAFVLVAHNTIRLQILSRKEEIEITKLLGAPASFIRRPFLYQAMWQSIFSAAVSL GLCGWLLSAVRPLVDAIFKPYGLNIGWRFFYVGELGLVFGFVIALGVFGAWLATTQHLLC FKAKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsX |
Synonyms | ftsX; Cell division protein FtsX |
UniProt ID | P95357 |
◆ Native Proteins | ||
SPARC-30653TH | Native Human SPARC | +Inquiry |
LDL-243H | Native Human Lipoproteins, Intermediate Density | +Inquiry |
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
Ubiquitin-001 | Biotinylated Ubiquitin | +Inquiry |
IgG-334D | Native Donkey IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart-490C | Chicken Heart Lysate, Total Protein | +Inquiry |
FETUB-2022HCL | Recombinant Human FETUB cell lysate | +Inquiry |
GJB4-5917HCL | Recombinant Human GJB4 293 Cell Lysate | +Inquiry |
ATXN3-52HCL | Recombinant Human ATXN3 lysate | +Inquiry |
ZNF800-5HCL | Recombinant Human ZNF800 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsX Products
Required fields are marked with *
My Review for All ftsX Products
Required fields are marked with *
0
Inquiry Basket