Recombinant Full Length Caulobacter Crescentus Glucans Biosynthesis Glucosyltransferase H(Opgh) Protein, His-Tagged
Cat.No. : | RFL7864CF |
Product Overview : | Recombinant Full Length Caulobacter crescentus Glucans biosynthesis glucosyltransferase H(opgH) Protein (Q9A6R5) (1-663aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caulobacter crescentus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-663) |
Form : | Lyophilized powder |
AA Sequence : | MSDRSSLFDVRSSTSVTLDQVVRRDTVEIPDEAALAMPVQPLSFWQGGARRATALTQDMN LRRWMLGLMTIAMGVAGWKASFDTIALGGVTRLEAVVLTLLAPLFLALSLWFCTALIGFV VLMGRPKDPLGIDSEAPMPKLHTRTAILMPVYNEDAAAVFARLRAMDASIAETGSARNFD IFVISDTRDAQVALAEQACFARFRREANCNVYYRIRKENTGRKAGNVADWVSRWGSAYEH MLVLDADSLMTGEAMVRLADAMERHPGAGLIQTMPMIINGQTIFARTLQFATRLYGRVAW TGLAWWSGSESSFWGHNAIVRTRAFAETCGLPHLPGPKPFGGEVMSHDALESALLRRGGW SVHLAPYLDGSYEESPSNLLDFATRDRRWCRGNIQHVPLIALPGLHWMSRMHLVIGVLSY ALSPLWFFCLSAGLISRALMPELKKAAFTMADLKAAAHALIDWSEIQATAWAMIITFVLL FGPKILGAILVLARKGEVKGFGGKRRMAAGLGVEMLLSALVAPMLMFTQTRAIVEILAGK VGGWAAQRRDADKVDFKEAWAAMGWISLSGLILAASFWFTPDLLTATAPILAGLVLAVPL TMLGAHKVAGLKLKANGLFMTPEERRPPAIVRAAVGAACEPPIRWFARNGRPIGPTTKIR DAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | opgH |
Synonyms | opgH; CC_2018; Glucans biosynthesis glucosyltransferase H |
UniProt ID | Q9A6R5 |
◆ Recombinant Proteins | ||
MALT1-8151HFL | Recombinant Full Length Human MALT1, Flag-tagged | +Inquiry |
NOP14-1122Z | Recombinant Zebrafish NOP14 | +Inquiry |
Tnfsf14-243M | Active Recombinant Mouse Tnfsf14 Protein (Arg58-Val239), C-His tagged, Animal-free, Carrier-free | +Inquiry |
SE-P102-2709S | Recombinant Staphylococcus epidermidis ATCC 12228 SE_P102 protein, His-tagged | +Inquiry |
TUF1-1549A | Recombinant Acinetobacter Baumannii TUF1 Protein (1-396 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
PLF4-88H | Active Native Human PF 4 | +Inquiry |
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-1719P | Native Peanut Lectin, FITC conjugated | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-260H | Human Kidney Liver Cirrhosis Lysate | +Inquiry |
SIT1-1827HCL | Recombinant Human SIT1 293 Cell Lysate | +Inquiry |
MRPL21-4188HCL | Recombinant Human MRPL21 293 Cell Lysate | +Inquiry |
NLE1-3809HCL | Recombinant Human NLE1 293 Cell Lysate | +Inquiry |
DOCK7-504HCL | Recombinant Human DOCK7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All opgH Products
Required fields are marked with *
My Review for All opgH Products
Required fields are marked with *
0
Inquiry Basket