Recombinant Full Length Carassius Auratus Red-Sensitive Opsin Protein, His-Tagged
Cat.No. : | RFL14990CF |
Product Overview : | Recombinant Full Length Carassius auratus Red-sensitive opsin Protein (P32313) (1-357aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Carassius auratus (Goldfish) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-357) |
Form : | Lyophilized powder |
AA Sequence : | MAEQWGDAIFAARRRGDETTRESMFVYTNSNNTRDPFEGPNYHIAPRWVYNLATVWMFFV VVASTFTNGLVLVATAKFKKLRHPLNWILVNLAVADLAETLLASTISVTNQFFGYFILGH PMCIFEGFTVSVCGIAGLWSLTVISWERWVVVCKPFGNVKFDAKWASAGIIFSWVWSAIW CAPPIFGWSRFWPHGLKTSCGPDVFSGSEDPGVQSYMIVLMITCCIIPLAIIILCYIAVW LAIRTVAQQQKDSESTQKAEKEVSRMVVVMIFAYCFCWGPYTFCACFAAANPGYAFHPLA AAMPAYFAKSATIYNPIIYVFMNRQFRVCIMQLFGKKVDDGSEVSTSKTEVSSVAPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Carassius auratus Red-sensitive opsin |
Synonyms | Red-sensitive opsin; Red cone photoreceptor pigment |
UniProt ID | P32313 |
◆ Recombinant Proteins | ||
DARS-2391H | Recombinant Human DARS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Il17d-7979R | Recombinant Rat Il17d protein, His & T7-tagged | +Inquiry |
CREB3L4-1967M | Recombinant Mouse CREB3L4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35441GF | Recombinant Full Length Chicken Cadherin-4(Cdh4) Protein, His-Tagged | +Inquiry |
STOML2-318H | Recombinant Human STOML2 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
MBLG-167B | Native Bovine milk β-Lactoglobulin | +Inquiry |
PLC-30 | Active Native Phospholipase C | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCX-7031HCL | Recombinant Human DCX 293 Cell Lysate | +Inquiry |
Thalamus-518R | Rhesus monkey Thalamus Lysate | +Inquiry |
CCDC89-7743HCL | Recombinant Human CCDC89 293 Cell Lysate | +Inquiry |
Fetal Brain-132H | Human Fetal Brain Stem Lysate | +Inquiry |
TRIM26-787HCL | Recombinant Human TRIM26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Carassius auratus Red-sensitive opsin Products
Required fields are marked with *
My Review for All Carassius auratus Red-sensitive opsin Products
Required fields are marked with *
0
Inquiry Basket