Recombinant Full Length Carassius Auratus D(1) Dopamine Receptor Protein, His-Tagged
Cat.No. : | RFL3038CF |
Product Overview : | Recombinant Full Length Carassius auratus D(1) dopamine receptor Protein (P35406) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Carassius auratus (Goldfish) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MAVLDLNLTTVIDSGFMESDRSVRVLTGCFLSVLILSTLLGNTLVCAAVTKFRHLRSKVT NFFVISLAVSDLLVAVLVMPWKAVTEVAGFWPFGAFCDIWVAFDIMCSTASILNLCVISV DRYWAISSPFRYERKMTPRVAFVMISGAWTLSVLISFIPVQLKWHKAQPIGFLEVNASRR DLPTDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTQIYRIAQKQIRRISALERAAESAQ IRHDSMGSGSNMDLESSFKLSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCKRTS NGLPCISPTTFDVFVWFGWANSSLNPIIYAFNADFRRAFAILLGCQRLCPGSISMETPSL NKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Carassius auratus D(1) dopamine receptor |
Synonyms | D(1 dopamine receptor; Dopamine D1 receptor |
UniProt ID | P35406 |
◆ Recombinant Proteins | ||
WARS-3698H | Recombinant Human WARS, GST-tagged | +Inquiry |
RFL14048MF | Recombinant Full Length Mouse G-Protein Coupled Bile Acid Receptor 1(Gpbar1) Protein, His-Tagged | +Inquiry |
PMCH-172H | Recombinant Human PMCH, His-tagged | +Inquiry |
RFL24943RF | Recombinant Full Length Rat Myelin Proteolipid Protein(Plp1) Protein, His-Tagged | +Inquiry |
SPIN1-15883M | Recombinant Mouse SPIN1 Protein | +Inquiry |
◆ Native Proteins | ||
PLAT-29690TH | Native Human Human SERPINE1 | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
C3-05M | Native Mouse C3 Protein | +Inquiry |
DIS-2020 | Active Cyclodextrin Glucanotransferase (Powder) | +Inquiry |
Lectin-1766D | Active Native Datura Stramonium Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRED2-1497HCL | Recombinant Human SPRED2 293 Cell Lysate | +Inquiry |
RGS3-2375HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
EPS8L1-570HCL | Recombinant Human EPS8L1 cell lysate | +Inquiry |
LIG1-985HCL | Recombinant Human LIG1 cell lysate | +Inquiry |
CDH18-765CCL | Recombinant Cynomolgus CDH18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Carassius auratus D(1) dopamine receptor Products
Required fields are marked with *
My Review for All Carassius auratus D(1) dopamine receptor Products
Required fields are marked with *
0
Inquiry Basket