Recombinant Full Length Capsule Polysaccharide Export Inner-Membrane Protein Kpse(Kpse) Protein, His-Tagged
Cat.No. : | RFL782EF |
Product Overview : | Recombinant Full Length Capsule polysaccharide export inner-membrane protein kpsE(kpsE) Protein (P62586) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MLIKVKSAVSWMRARLSAISLADIQKHLAKIIILAPMAVLLIYLAIFSQPRYMSESKVAI KRSDDLNSGSLNFGLLLGASNPSSAEDALYLKEYINSPDMLAALDKQLNFREAFSHSGLD FLNHLSKDETAEGFLKYYKDRINVSYDDKTGLLNIQTQGFSPEFALKFNQTVLKESERFI NEMSHRIARDQLAFAETEMEKARQRLDASKAELLSYQDNNNVLDPQAQAQAASTLVNTLM GQKIQMEADLRNLLTYLREDAPQVVSARNAIQSLQAQIDEEKSKITAPQGDKLNRMAVDF EEIKSKVEFNTELYKLTLTSIEKTRVEAARKLKVLSVISSPQLPQESSFPNIPYLIACWL LVCCLLFGTLKLLLAVIEDHRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kpsE |
Synonyms | kpsE; Capsule polysaccharide export inner-membrane protein KpsE |
UniProt ID | P62586 |
◆ Recombinant Proteins | ||
UNC119B-484H | Recombinant Human UNC119B Protein, MYC/DDK-tagged | +Inquiry |
STX12-286Z | Recombinant Zebrafish STX12 | +Inquiry |
LYPD3-6238HF | Recombinant Full Length Human LYPD3 Protein, GST-tagged | +Inquiry |
ABHD12-15R | Recombinant Rhesus Macaque ABHD12 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNC-4224H | Recombinant Human TNC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
COP34 | Native Ginkgo Biloba L. EP7 | +Inquiry |
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
COL6-116H | Native Human Collagen type VI | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS25-395HCL | Recombinant Human VPS25 293 Cell Lysate | +Inquiry |
SCML2-2032HCL | Recombinant Human SCML2 293 Cell Lysate | +Inquiry |
CKB-001HCL | Recombinant Human CKB cell lysate | +Inquiry |
VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
AADAT-9158HCL | Recombinant Human AADAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kpsE Products
Required fields are marked with *
My Review for All kpsE Products
Required fields are marked with *
0
Inquiry Basket