Recombinant Full Length Capsule Polysaccharide Export Inner-Membrane Protein Kpse(Kpse) Protein, His-Tagged
Cat.No. : | RFL19692EF |
Product Overview : | Recombinant Full Length Capsule polysaccharide export inner-membrane protein kpsE(kpsE) Protein (P42501) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MLIKVKSAVSWMRARLSAISLADIQKHLAKIIILAPMAMLLIYLAIFSQPRYMSESKVAI KRSDDLNSGSLNFGLLLGASNPSSAEDALYLKEYINSPDMLAALDKQLNFREAFSHSGLD FLNHLSKDETAEGFLKYYKDRINVSYDDKTGLLNIQTTGFSPEFALKFNQTVLKESERFI NEMSHRIARDQLAFAETEMEKARQRLDASKAELLSYQDNNNVLDPQAQAQAASTLVNTLM GQKIQMEADLRNLLTYLREDAPQVVSARNAIQSLQAQIDEEQSKITAPQGDKLNRMAVDF EEIKSKVEFNTELYKLTLTSIEKTRVEAARKLKVLSVISSPQLPQESSFPNIPYLIACWL LVCCLLFGTLKLLLAVIEDHRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kpsE |
Synonyms | kpsE; Capsule polysaccharide export inner-membrane protein KpsE |
UniProt ID | P42501 |
◆ Recombinant Proteins | ||
SPHK1-012H | Recombinant Human SPHK1 Protein, His-tagged | +Inquiry |
SCN4B-461H | Recombinant Human SCN4B Protein, MYC/DDK-tagged | +Inquiry |
sseL-172S | Recombinant Salmonella sseL, His-tagged | +Inquiry |
IGFBP1-3007R | Recombinant Rat IGFBP1 Protein | +Inquiry |
SLC10A2-5419R | Recombinant Rat SLC10A2 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1749G | Active Native Galanthus Nivalis Lectin Protein | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
IgA-242D | Native Dog Immunoglobulin A | +Inquiry |
TF-132B | Native Bovine Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS12-2175HCL | Recombinant Human RPS12 293 Cell Lysate | +Inquiry |
MBTPS1-4435HCL | Recombinant Human MBTPS1 293 Cell Lysate | +Inquiry |
PABPC1-1269HCL | Recombinant Human PABPC1 cell lysate | +Inquiry |
RGS7-2369HCL | Recombinant Human RGS7 293 Cell Lysate | +Inquiry |
SLC37A3-1727HCL | Recombinant Human SLC37A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kpsE Products
Required fields are marked with *
My Review for All kpsE Products
Required fields are marked with *
0
Inquiry Basket