Recombinant Full Length Capsicum Annuum 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase 2(Hmgr2) Protein, His-Tagged
Cat.No. : | RFL6330CF |
Product Overview : | Recombinant Full Length Capsicum annuum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2(HMGR2) Protein (Q9XEL8) (1-604aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Capsicum annuum (Bell pepper) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-604) |
Form : | Lyophilized powder |
AA Sequence : | MDVRRRSEEAVYSSKVFAADEKPLKPHKQQQEEDNTLLIDASDALPLPLYFTNGLFFTMF FSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFVARGNN DSWDEEDENDEQFILEEDSRRGPCAAATTLGCAVPTPPAKHIAPIVPQQPAVSIAEKPAP LVTPAASEEDEEIIKSVVQGKIPSYSLESKLGDCKRAASIRKEVLQRITGKSLEGLPLDG FNYESILGQCCEMTIGYVQIPVGIAGPLLLNGREYSVPMATTEGCLVASTNRGCKAIYAS GGATSILLRDGMTRAPCVRFGTAKRAAELKFFVEDPINFETLANVFNQSSRFARLQRIQC AIAGKNLHMRFVCSTGDAMGMNMVSKGVQNVLDYLQNEYADMDVIGISANFCSDKKPAAV NWIEGRGKSVVCEAIITEEVVKKVLKTEVAALVELNMLKNLTGSALAGALGGFNAHASNI VSAVYIATGQDPAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSAC LNLLGVKGANREAPGSNARLLATIVAGSVLAGELSLMSAISAGQLVNSHMKYNRSTKDVT KASS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HMGR2 |
Synonyms | HMGR2; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2; HMG-CoA reductase 2 |
UniProt ID | Q9XEL8 |
◆ Recombinant Proteins | ||
HCN1-1180HFL | Recombinant Human HCN1 protein, His&Flag-tagged | +Inquiry |
BET1-532R | Recombinant Rhesus monkey BET1 Protein, His-tagged | +Inquiry |
NPM3-6166M | Recombinant Mouse NPM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R9B-13248M | Recombinant Mouse PPP1R9B Protein | +Inquiry |
PAFAH2-4791H | Recombinant Human PAFAH2 Protein (Met1-Leu392), N-His tagged | +Inquiry |
◆ Native Proteins | ||
C3-05M | Native Mouse C3 Protein | +Inquiry |
MPOC-235H | Active Native Human Myeloperoxidase Isoform C | +Inquiry |
LYZ-139C | Native Chicken lysozyme | +Inquiry |
IgG-154R | Native Rabbit Immunoglobulin G | +Inquiry |
Lectin-1852U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 649 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMG2-2735HCL | Recombinant Human PSMG2 293 Cell Lysate | +Inquiry |
COMMD2-7371HCL | Recombinant Human COMMD2 293 Cell Lysate | +Inquiry |
Prostate-402H | Human Prostate Cytoplasmic Tumor Lysate | +Inquiry |
ATP4A-8608HCL | Recombinant Human ATP4A 293 Cell Lysate | +Inquiry |
CSRP3-7229HCL | Recombinant Human CSRP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGR2 Products
Required fields are marked with *
My Review for All HMGR2 Products
Required fields are marked with *
0
Inquiry Basket