Recombinant Full Length Candida Parapsilosis Nadh-Ubiquinone Oxidoreductase Chain 6(Nd6) Protein, His-Tagged
Cat.No. : | RFL2440CF |
Product Overview : | Recombinant Full Length Candida parapsilosis NADH-ubiquinone oxidoreductase chain 6(ND6) Protein (P48923) (1-155aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida parapsilosis (Yeast) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-155) |
Form : | Lyophilized powder |
AA Sequence : | MFLISGISSILAIGLLSPVQSIVCLIVLFVSAAISLYSNGFVLMGILYVLIYVGAIAILF LFILSLLNIEYNYKGTIHPLIFTILIICLIPLDLSYETYGIVENVNIAYPFNSLLDWDLE LTTVGSLLYTEYAIPMILIGLILILSVIGAIAITK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ND6 |
Synonyms | ND6; NAD6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6 |
UniProt ID | P48923 |
◆ Native Proteins | ||
Plg-5465R | Native Rat Plasminogen | +Inquiry |
HB-42P | Native Pig Hemoglobin (HB) Protein | +Inquiry |
IgG-7437M | Native Mouse IgG Protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
FG-164B | Native Bovine fibrinogen degradation products | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR2DL1-1657HCL | Recombinant Human KIR2DL1 cell lysate | +Inquiry |
VPS41-386HCL | Recombinant Human VPS41 293 Cell Lysate | +Inquiry |
ST3GAL2-1702HCL | Recombinant Human ST3GAL2 cell lysate | +Inquiry |
Jejunum-674H | Hamster Jejunum Lysate, Total Protein | +Inquiry |
IRX6-875HCL | Recombinant Human IRX6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ND6 Products
Required fields are marked with *
My Review for All ND6 Products
Required fields are marked with *
0
Inquiry Basket