Recombinant Full Length Candida Glabrata Topoisomerase I Damage Affected Protein 7(Tda7) Protein, His-Tagged
Cat.No. : | RFL34748CF |
Product Overview : | Recombinant Full Length Candida glabrata Topoisomerase I damage affected protein 7(TDA7) Protein (Q6FNJ6) (1-629aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-629) |
Form : | Lyophilized powder |
AA Sequence : | MIHNSSYTEAADIKSLSSFIEESSRVPDYISESNNIGWSSNINNPPLFESSSFDITTQND NWILTETMQNITTESSSTFSRSVASSVFPSSSQAFVSPPSIIDIPISSIPESSSISISSD VLSSAITVSQTSSSSYSSLISSYSTIQSTSSSSISENEISSSSRISPGLLSSVPSITTSF SSGISSSVSPTSSLQQIAEQSSNSSLAENDLLSSSLTILSSVLSSSVLLHNSGVSSSSFT DNFSSTLTNSSNSLAILSSISESSLINTITDLPSSSVLLSPNNSESSIKVSSASSSSSRR KASTYTTPSRIPFSNSSEWYTPLPTPSISSSTNDTSSLLSELALIGISSSSSSSSSSQFY TSSTSSSSLVSSSENYSSSQPTTIEPITSTISSSYSDLSNDGEILSSTLGKSVYYSYIQT FDITASTTTFETALPIVTAFNLKDSYTFSKPSSIITTDLHFYKDWLSGALDSNEENGNKS KNAGTIAGSVVGSVVGLLVCTLIVWYFYIRKRRRNQKWKSFEVPSRSKDVEYNNNDNPFN NEFDFQHRVPPPLPPQRKNHNSIGVPPSSMGLSNTRSADYHMRFSYISSSTDSSDDYSDS MQSALHIGSDSGRERSNDVPEMGYLREII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TDA7 |
Synonyms | TDA7; CAGL0J11176g; Topoisomerase I damage affected protein 7 |
UniProt ID | Q6FNJ6 |
◆ Recombinant Proteins | ||
RALA-3594R | Recombinant Rhesus Macaque RALA Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBA8-17614M | Recombinant Mouse TUBA8 Protein | +Inquiry |
ANKRD13C-2070H | Recombinant Human ANKRD13C Protein, MYC/DDK-tagged | +Inquiry |
NSD1-035H | Recombinant Human NSD1 Protein, GST-tagged | +Inquiry |
CNFN-1374Z | Recombinant Zebrafish CNFN | +Inquiry |
◆ Native Proteins | ||
TNC-08H | Native Human TNC Protein | +Inquiry |
IgG1-226H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
F2-90B | Active Native Bovine Thrombin | +Inquiry |
PLAU-8456H | Active Native Human PLAU | +Inquiry |
CA2-35R | Native Rhesus monkey Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDPK1-3322HCL | Recombinant Human PDPK1 293 Cell Lysate | +Inquiry |
ACTB-20HCL | Recombinant Human ACTB cell lysate | +Inquiry |
TOM1-1807HCL | Recombinant Human TOM1 cell lysate | +Inquiry |
TMEM237-8891HCL | Recombinant Human ALS2CR4 293 Cell Lysate | +Inquiry |
RPS6KA1-2162HCL | Recombinant Human RPS6KA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDA7 Products
Required fields are marked with *
My Review for All TDA7 Products
Required fields are marked with *
0
Inquiry Basket