Recombinant Full Length Candida Glabrata Protein Sym1(Sym1) Protein, His-Tagged
Cat.No. : | RFL1420CF |
Product Overview : | Recombinant Full Length Candida glabrata Protein SYM1(SYM1) Protein (Q6FXJ3) (1-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-210) |
Form : | Lyophilized powder |
AA Sequence : | MIRLFQLYEHQLKVRPKLTNSIMTGALFGIGDVSAQLLFPSGPDTLPPSAQTNDVKRGKY DIPRTVRAVVYGSMIFSFIGDRWYRFLTKVKFSNKPAKHWSNMVLRVCVDQLGFAPLGLP FYFGCMSLLEGHGLGAAREKIKLQWWDTLKTNWCVWPLFQMVNFSLVPLQHRLLAANVVA IFWNTFLSYTNSQIPVGGHKLTVQYPPTVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SYM1 |
Synonyms | SYM1; CAGL0B03465g; Protein SYM1 |
UniProt ID | Q6FXJ3 |
◆ Recombinant Proteins | ||
SH3BP5-1332H | Recombinant Human SH3BP5 Protein, MYC/DDK-tagged | +Inquiry |
Irf7-3578M | Recombinant Mouse Irf7 Protein, Myc/DDK-tagged | +Inquiry |
Acbd3-1489M | Recombinant Mouse Acbd3 Protein, Myc/DDK-tagged | +Inquiry |
ARHGAP18-1857M | Recombinant Mouse ARHGAP18 Protein | +Inquiry |
RALGPS1-5884Z | Recombinant Zebrafish RALGPS1 | +Inquiry |
◆ Native Proteins | ||
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
A35R-01M | Native Monkeypox virus A35R protein | +Inquiry |
APOA1-8344H | Native Human APOA1 | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
Collagen-120B | Native Bovine Type I Collagen, FITC-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
FIG4-6218HCL | Recombinant Human FIG4 293 Cell Lysate | +Inquiry |
KIF7-4943HCL | Recombinant Human KIF7 293 Cell Lysate | +Inquiry |
Pituitary-383H | Human Pituitary Membrane Lysate | +Inquiry |
ADRB2-34HCL | Recombinant Human ADRB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYM1 Products
Required fields are marked with *
My Review for All SYM1 Products
Required fields are marked with *
0
Inquiry Basket