Recombinant Full Length Candida Glabrata Ph-Response Regulator Protein Pali/Rim9(Rim9) Protein, His-Tagged
Cat.No. : | RFL9935CF |
Product Overview : | Recombinant Full Length Candida glabrata pH-response regulator protein palI/RIM9(RIM9) Protein (Q6FU42) (1-246aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-246) |
Form : | Lyophilized powder |
AA Sequence : | MHLFDLRTLLAILVSICVVFQAFPLATVPLNKNLILGQYMGYHFGVFGWCFVDKGVTIAC HCKFRPDSIETYKYTDQLLFPSLYKVTISTLLVVHPVSFAFTCILWIMALIIRLSRFGRC PIFILSAATWSLAAFLLALLSALVDLLLFVNKLKWPGWLVLASVPLMAICCSWLWSLRRQ VSAIFYERKAYATQTYSRFDSMELSHIDTKFSDDQSIYETYTLERVPYSKNEAIEEPALT YYTSSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIM9 |
Synonyms | RIM9; CAGL0F06545g; pH-response regulator protein palI/RIM9 |
UniProt ID | Q6FU42 |
◆ Recombinant Proteins | ||
PLEKHG6-6836M | Recombinant Mouse PLEKHG6 Protein, His (Fc)-Avi-tagged | +Inquiry |
SIGLEC5-5941H | Recombinant Human SIGLEC5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL19127HF | Recombinant Full Length Haemophilus Influenzae Probable Cytochrome Oxidase Subunit 1 (Hi_1076) Protein, His-Tagged | +Inquiry |
A284-RS24560-5931S | Recombinant Staphylococcus warneri SG1 A284_RS24560 protein, His-tagged | +Inquiry |
PLXNB2-2161H | Active Recombinant Human PLXNB2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
GG-187B | Native Bovine Gamma Globulin protein | +Inquiry |
CVB1-12 | Native Coxsackievirus B1 Antigen | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARCO-2563MCL | Recombinant Mouse MARCO cell lysate | +Inquiry |
TMEM106C-1015HCL | Recombinant Human TMEM106C 293 Cell Lysate | +Inquiry |
CNPY3-7396HCL | Recombinant Human CNPY3 293 Cell Lysate | +Inquiry |
KIF22-927HCL | Recombinant Human KIF22 cell lysate | +Inquiry |
FADS3-6471HCL | Recombinant Human FADS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RIM9 Products
Required fields are marked with *
My Review for All RIM9 Products
Required fields are marked with *
0
Inquiry Basket