Recombinant Full Length Candida Glabrata Palmitoyltransferase Pfa5(Pfa5) Protein, His-Tagged
Cat.No. : | RFL34293CF |
Product Overview : | Recombinant Full Length Candida glabrata Palmitoyltransferase PFA5(PFA5) Protein (Q6FMP5) (1-352aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-352) |
Form : | Lyophilized powder |
AA Sequence : | MGFAEWRLRNKYWTIYIVPLVVLLLMIYGTWAYCHKLCYERVYRDFGHKATAIGLICTCC VLDALIIAIWVLIVSCGPGHQPGVAPHLLVDSADLENTTVAPNCYQSDPHGYPVWCSNCQ SLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAVLLMIVWITISVY IRDIRQYHARLNANLIVLLIISGIGWLMTSGLFVSYIYYMSQNLTSIEVIDLKKRKRTPE LSMQRLYCYYNSDDHYRYVVKLDNDFKGSVYKKHWLKNIKEFMGSNPMLWFIPLPQYWHE SPLANGERDVNTIVSPYQEEVGPHTIDYIKKRIESGEYIHKFKEPGREKTHL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA5 |
Synonyms | PFA5; CAGL0K06347g; Palmitoyltransferase PFA5; Protein fatty acyltransferase 5 |
UniProt ID | Q6FMP5 |
◆ Recombinant Proteins | ||
CXCL11-202H | Recombinant Human CXCL11 Protein, His-tagged | +Inquiry |
C16orf70-6192H | Recombinant Human C16orf70 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
L1CAM-26864TH | Recombinant Human L1CAM, His-tagged | +Inquiry |
MECP2-3289R | Recombinant Rat MECP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14693SF | Recombinant Full Length Salmonella Heidelberg Cation-Efflux Pump Fief(Fief) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ctxB-146V | Native Cholera Toxin B | +Inquiry |
CRP-5330H | Native Canine CRP protein | +Inquiry |
F12-28805TH | Native Human F12 | +Inquiry |
MUC1-135B | Native Bovine MUC1 Protein | +Inquiry |
C4-12H | Active Native Human C4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5SL-8593HCL | Recombinant Human ATP5SL 293 Cell Lysate | +Inquiry |
D2HGDH-7088HCL | Recombinant Human D2HGDH 293 Cell Lysate | +Inquiry |
PGLS-3255HCL | Recombinant Human PGLS 293 Cell Lysate | +Inquiry |
NEUROD1-3868HCL | Recombinant Human NEUROD1 293 Cell Lysate | +Inquiry |
LTB4R2-9166HCL | Recombinant Human LTB4R2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFA5 Products
Required fields are marked with *
My Review for All PFA5 Products
Required fields are marked with *
0
Inquiry Basket