Recombinant Full Length Candida Glabrata Nuclear Rim Protein 1(Nur1) Protein, His-Tagged
Cat.No. : | RFL32786CF |
Product Overview : | Recombinant Full Length Candida glabrata Nuclear rim protein 1(NUR1) Protein (Q6FL09) (1-438aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-438) |
Form : | Lyophilized powder |
AA Sequence : | MFSWLIPDIPELFLTISVWFRLQGWEDNTKLGFIIGNTLTTIFYILRLAQDTLLAGVSRK LIRDYELFDLSKSETLLSDPAFSSYHDVLFNKHHSTANASSYNKRVRKVTSTVYWSTYFL LLLSCYTCYRLFNTYKVYRIYYLKDLNLDKHPSLKKIEPDYEVDEKLLKTSLKSKLLSRF IRLLQLQDEVETELPKVTEHYTLNKWDPSKLIISLSTSFSPTIIICLMYTNVTFLTVIPI IIHQGIFYFMIWNRYEERFKDDALLMRENYLQYDTKYVKPLKQIMYQDVMTDTATISDGG FTKFFPVSKSTLFKHHEMSGDVIIERYNKKSREFENVTDIIKPHHHINNTVKILPPTIRK DHKTNRYDHRQQSILKDRKFNIDSNEPQIINALTTAIPSRSFFNNNPSGSNDDNCSGIKV RSSPTRETFFPATPLRKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NUR1 |
Synonyms | NUR1; CAGL0L07084g; Nuclear rim protein 1 |
UniProt ID | Q6FL09 |
◆ Recombinant Proteins | ||
OSCAR-6414M | Recombinant Mouse OSCAR Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL23048MF | Recombinant Full Length Probable Cation-Transporting P-Type Atpase C(Ctpc) Protein, His-Tagged | +Inquiry |
PUCM-0385B | Recombinant Bacillus subtilis PUCM protein, His-tagged | +Inquiry |
CDCA8-11027H | Recombinant Human CDCA8, His-tagged | +Inquiry |
GALNTL1-13142H | Recombinant Human GALNTL1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1842S | Active Native Solanum Tuberosum Lectin Protein, Biotinylated | +Inquiry |
RBP-94H | Native Human Retinol-Binding Protein | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
PLG-27842TH | Native Human PLG | +Inquiry |
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf54-8343HCL | Recombinant Human C11orf54 293 Cell Lysate | +Inquiry |
CLDN15-7469HCL | Recombinant Human CLDN15 293 Cell Lysate | +Inquiry |
TYROBP-613HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
ETHE1-6529HCL | Recombinant Human ETHE1 293 Cell Lysate | +Inquiry |
GTSF1-5679HCL | Recombinant Human GTSF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUR1 Products
Required fields are marked with *
My Review for All NUR1 Products
Required fields are marked with *
0
Inquiry Basket