Recombinant Full Length Candida Glabrata 3-Ketodihydrosphingosine Reductase Tsc10(Tsc10) Protein, His-Tagged
Cat.No. : | RFL15853CF |
Product Overview : | Recombinant Full Length Candida glabrata 3-ketodihydrosphingosine reductase TSC10(TSC10) Protein (Q6FQ42) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MFCLEDQVVLIAGGSQGLGKQFGQKYWDESRHSKIILVSRSDVKLRNAITDITGGRQEPV ELVMPEVAASEPSASGSSAINLSKSSNHAGFESELRSNSNRSSSSLKESTNVVTHLTTNA ADSRIVYIACDLSDPDAVERMFVTLQHNNLLPTQVLACAGGSIPKLFTDLTAKELEMGVK MNYMTTLFVIHKAAQMVPQAHLILFSSSTAFFPFIGYSQYAPAKVSLKALTSILRHELPN TRISCVYPGNFYSEGYVLEEMSKPDITKSIEGSSYPISCEECCDKIVWWLNRGYDDVTTD SIGWFLMSLDMGLNKHNNNSAYWFVQWLIGVIANLLVVPFYMVLCSYQINKWHKQNKNKN TLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TSC10 |
Synonyms | TSC10; CAGL0I09328g; 3-ketodihydrosphingosine reductase TSC10; 3-dehydrosphinganine reductase; KDS reductase |
UniProt ID | Q6FQ42 |
◆ Recombinant Proteins | ||
TPM4-9539M | Recombinant Mouse TPM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLPQ-0798B | Recombinant Bacillus subtilis GLPQ protein, His-tagged | +Inquiry |
CCNYL1-301397H | Recombinant Human CCNYL1 protein, GST-tagged | +Inquiry |
FAM117AB-6792Z | Recombinant Zebrafish FAM117AB | +Inquiry |
Lmbr1-3799M | Recombinant Mouse Lmbr1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Histone-53C | Native Calf Histone Protein | +Inquiry |
PROC-272B | Active Native Bovine Activated Protein C | +Inquiry |
Fxa-282B | Active Native Bovine Factor Xa - EGR | +Inquiry |
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
Cela1 -71R | Active Native Rat pancreatic elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-88C | Cynomolgus monkey Colon Lysate | +Inquiry |
ZER1-189HCL | Recombinant Human ZER1 293 Cell Lysate | +Inquiry |
FAM113A-6452HCL | Recombinant Human FAM113A 293 Cell Lysate | +Inquiry |
ITM2A-5118HCL | Recombinant Human ITM2A 293 Cell Lysate | +Inquiry |
NR2F2-1217HCL | Recombinant Human NR2F2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TSC10 Products
Required fields are marked with *
My Review for All TSC10 Products
Required fields are marked with *
0
Inquiry Basket