Recombinant Full Length Candida Dubliniensis Golgi To Er Traffic Protein 1(Get1) Protein, His-Tagged
Cat.No. : | RFL5391CF |
Product Overview : | Recombinant Full Length Candida dubliniensis Golgi to ER traffic protein 1(GET1) Protein (B9WA88) (1-199aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida dubliniensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-199) |
Form : | Lyophilized powder |
AA Sequence : | MLLPDLHPYTILLSIFIVLLLKQLVASIGKSTIKEFVWLVYLKVSSNQSIKTYNSKQHEL HETNKEKRAISAQDEYAKWTKLNRQADKLSAELQKLNQEIQQQKASIDKVSNALLLVLTT LPIWVARVLYRNTHLFYIRQGIFPKYVEWVLALPFLPNGAVGLTIWMFAVNSVVSNFAFL VSFPFAKKVSKPVRDTKIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GET1 |
Synonyms | GET1; CD36_15290; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1 |
UniProt ID | B9WA88 |
◆ Recombinant Proteins | ||
RP9-7710M | Recombinant Mouse RP9 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASP6L2-3695Z | Recombinant Zebrafish CASP6L2 | +Inquiry |
Igf1-814R | Recombinant Rat Igf1 protein, His & GST-tagged | +Inquiry |
BTRC-2545M | Recombinant Mouse BTRC Protein | +Inquiry |
PARVG-130H | Recombinant Human PARVG Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
F10-302R | Native Rat Factor X | +Inquiry |
Luciferase-10V | Native Vibrio fischeri Luciferase | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS11-557HCL | Recombinant Human RPS11 lysate | +Inquiry |
RNF24-2280HCL | Recombinant Human RNF24 293 Cell Lysate | +Inquiry |
ACOX1-511HCL | Recombinant Human ACOX1 cell lysate | +Inquiry |
PCDHAC2-3395HCL | Recombinant Human PCDHAC2 293 Cell Lysate | +Inquiry |
FKBP1B-6209HCL | Recombinant Human FKBP1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GET1 Products
Required fields are marked with *
My Review for All GET1 Products
Required fields are marked with *
0
Inquiry Basket