Recombinant Full Length Candida Dubliniensis Altered Inheritance Of Mitochondria Protein 11(Aim11) Protein, His-Tagged
Cat.No. : | RFL9276CF |
Product Overview : | Recombinant Full Length Candida dubliniensis Altered inheritance of mitochondria protein 11(AIM11) Protein (B9WD58) (1-166aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida dubliniensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-166) |
Form : | Lyophilized powder |
AA Sequence : | MTDLLHKLNFKIADASPEYKQRRKIQMIRFFTASAVTIFASRFAYRATVSRQYIPTLFQG NHSPPLSYNFTTDAAVAVGTGTLLCGSVTGMTVFGLCWILDVSNIQEFGWRMKSMLGGWE SEKKLSEAPMDEESSYIQDSLNDILDGKYDFEEDTEEVHTAEMKTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AIM11 |
Synonyms | AIM11; CD36_80770; Altered inheritance of mitochondria protein 11 |
UniProt ID | B9WD58 |
◆ Native Proteins | ||
IgG-159B | Native Bovine Immunoglobulin G | +Inquiry |
AMY1B-31376TH | Native Human AMY1B | +Inquiry |
CAT-1847B | Active Native Bovine, Catalase | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
Complement C3a-46H | Native Human Complement C3a | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMBX1-487HCL | Recombinant Human DMBX1 cell lysate | +Inquiry |
Heart-215R | Rat Heart Membrane Lysate | +Inquiry |
CPB-106RM | Rabbit Anti-Mouse IgG Fc Secondary Polyclonal Antibody, HRP | +Inquiry |
XRCC4-255HCL | Recombinant Human XRCC4 293 Cell Lysate | +Inquiry |
PDE4A-3352HCL | Recombinant Human PDE4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIM11 Products
Required fields are marked with *
My Review for All AIM11 Products
Required fields are marked with *
0
Inquiry Basket