Recombinant Full Length Candida Albicans Squalene Synthase(Erg9) Protein, His-Tagged
Cat.No. : | RFL8772CF |
Product Overview : | Recombinant Full Length Candida albicans Squalene synthase(ERG9) Protein (P78589) (1-448aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-448) |
Form : | Lyophilized powder |
AA Sequence : | MGKFLQLLSHPTELKAVIQLFGFRQPLHPGKRDVNDKELGRCYELLNLTSRSFAAVIEEL HPELRDAVMIFYLVLRALDTIEDDMTIKSSIKIPLLREFDTKLNTKNWTFDGYGPNEKDR TVLVEFDKILNVYHRLKPQYQDIIKSITFKMGNGMADYILDEEFNVYGVATVEDYNLYCH YVAGLVGEGLTNLFVLANFGDKTLTENNFAKADSMGLFLQKTNIIRDYHEDLQDGRSFWP REIWSKYTENLQDFHKVKTPAKEFAGVSCINELVLNALGHVTDCLDYLSLVKDPSSFSFC AIPQVMAVATLAEVYNNPKVLHGVVKIRKGTTCRLILESRTLPGVVKIFKEYIQVINHKS SVRDPNYLKIGIKCGEIEQYCEMIYPNKQALPPSMKSLPENKFTKIVASRESIDLSVQRR IEPGNFNCNVVLFGIGALILSLIYFVLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG9 |
Synonyms | ERG9; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase |
UniProt ID | P78589 |
◆ Recombinant Proteins | ||
GPRC5A-1339H | Recombinant Human GPRC5A protein, GST-tagged | +Inquiry |
Itga6-1698M | Recombinant Mouse Itga6 Protein, His-tagged | +Inquiry |
EIF2C3-4571HF | Recombinant Full Length Human EIF2C3 Protein, GST-tagged | +Inquiry |
FAM175B-5537M | Recombinant Mouse FAM175B Protein | +Inquiry |
HA-3335V | Recombinant Influenza A H5N8 (A/Ch/Netherlands/14015526/2014) HA protein(Met1-Arg345), His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG1-014M | Native Mouse IgG1 Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
RSV-09 | Native Respiratory Syncytial Virus (RSV) Antigen | +Inquiry |
HP-190C | Native Dog Haptoglobin | +Inquiry |
Troponin T-12H | Native Human cardiac Troponin T protein | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H2BO-5533HCL | Recombinant Human HIST1H2BO 293 Cell Lysate | +Inquiry |
PPA1-2995HCL | Recombinant Human PPA1 293 Cell Lysate | +Inquiry |
SMARCAD1-1670HCL | Recombinant Human SMARCAD1 293 Cell Lysate | +Inquiry |
ANAPC4-73HCL | Recombinant Human ANAPC4 cell lysate | +Inquiry |
STARD5-1422HCL | Recombinant Human STARD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERG9 Products
Required fields are marked with *
My Review for All ERG9 Products
Required fields are marked with *
0
Inquiry Basket