Recombinant Full Length Candida Albicans Nadh-Ubiquinone Oxidoreductase Chain 4L(Nad4L) Protein, His-Tagged
Cat.No. : | RFL5746CF |
Product Overview : | Recombinant Full Length Candida albicans NADH-ubiquinone oxidoreductase chain 4L(NAD4L) Protein (Q9B8D0) (1-84aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-84) |
Form : | Lyophilized powder |
AA Sequence : | MIAVITTLLTYYMSSNNLITLLIAIEILLLTVTLKLIHISGYYDDIYGTIFSLIIIILAG AESAIGLSILVAYYRLRGTIGHSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NAD4L |
Synonyms | NAD4L; CM_00370W; CaalfMp12; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L |
UniProt ID | Q9B8D0 |
◆ Recombinant Proteins | ||
ZC3H6-4316C | Recombinant Chicken ZC3H6 | +Inquiry |
DOK1-1375H | Recombinant Human DOK1 Protein, His-tagged | +Inquiry |
RNF8-1281H | Recombinant Human RNF8 protein, His&Myc-tagged | +Inquiry |
C8orf4-4883H | Recombinant Human C8orf4 protein, GST-tagged | +Inquiry |
ABRA-2621H | Recombinant Human ABRA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
S100AA-258B | Native Bovine S-100αα Protein | +Inquiry |
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
Fva-285B | Active Native Bovine Factor Va | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLIG3-1249HCL | Recombinant Human OLIG3 cell lysate | +Inquiry |
HIST1H4H-5522HCL | Recombinant Human HIST1H4H 293 Cell Lysate | +Inquiry |
C9orf24-7935HCL | Recombinant Human C9orf24 293 Cell Lysate | +Inquiry |
TRPC4AP-743HCL | Recombinant Human TRPC4AP 293 Cell Lysate | +Inquiry |
GLS2-5895HCL | Recombinant Human GLS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAD4L Products
Required fields are marked with *
My Review for All NAD4L Products
Required fields are marked with *
0
Inquiry Basket