Recombinant Full Length Candida Albicans Mitochondrial Inner Membrane Magnesium Transporter Lpe10(Lpe10) Protein, His-Tagged
Cat.No. : | RFL27358CF |
Product Overview : | Recombinant Full Length Candida albicans Mitochondrial inner membrane magnesium transporter LPE10(LPE10) Protein (Q59S85) (20-453aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-453) |
Form : | Lyophilized powder |
AA Sequence : | LFLRQLNKKSKPNPHKNKNFDSFNEVFIHKTLLSSINQHNDTDYVRCSIFNANGDMIQHG KEILKSQFIKRYNLTPRDFRKFNWQRSATGTTTSSSSSSSSAGQTSSGTSKSSSLSSSSS SPHSTISALSLSNSSLGSSTNVDIVPNITIRRNSILVQLLNIRALINHDQLIIFDNSSSF QNSHVSSYTHSQFLKDLSQRLKSTNLDGLPFEFKALEGILIYIVSNLNMEMKVHNTVLQN IITGLEDSIDRNKLRYLLIESKKIHQFHRKITLIKNCLEDLLENDDELNDLYITEKFNSE GDGQPRQGTNHEEIEMLLENYYQTIDEIVQIVENLKNQIKTTEDLINVVLDSNRNQLMLL GLKFSTGLLSMGVALYVSALYGMNLENFIEEIDGGFEVVTVVSTIALIALLLFSVKQLKK VEKVTMTSLNDQRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LPE10 |
Synonyms | LPE10; CAALFM_C602150CA; CaO19.10959; CaO19.3455; Mitochondrial inner membrane magnesium transporter LPE10 |
UniProt ID | Q59S85 |
◆ Native Proteins | ||
pepsin -173P | Native Pig pepsin | +Inquiry |
APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
ALB-316B | Native Bovine Albumin Protein, Biotinylated | +Inquiry |
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
LH-9389B | Active Native Bovine LH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNHIT2-2096HCL | Recombinant Human ZNHIT2 cell lysate | +Inquiry |
LRRFIP1-4620HCL | Recombinant Human LRRFIP1 293 Cell Lysate | +Inquiry |
Skin-671H | Hamster Skin Lysate, Total Protein | +Inquiry |
C7-1500HCL | Recombinant Human C7 cell lysate | +Inquiry |
IL8-3004HCL | Recombinant Human IL8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LPE10 Products
Required fields are marked with *
My Review for All LPE10 Products
Required fields are marked with *
0
Inquiry Basket