Recombinant Full Length Candida Albicans Methylsterol Monooxygenase(Erg25) Protein, His-Tagged
Cat.No. : | RFL14302CF |
Product Overview : | Recombinant Full Length Candida albicans Methylsterol monooxygenase(ERG25) Protein (O59933) (1-308aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-308) |
Form : | Lyophilized powder |
AA Sequence : | MSSISNVYHDYSSFSNATTFSQVYQNFNQLDNLNVFEKLWGSYYYYMANDLFATGLLFFL THEIFYFGRCLPWAIIDRIPYFRKWKIQDEKIPSDKEQWECLKSVLTSHFLVEAFPIWFF HPLCQKIGISYQVPFPKITDMLIQWAVFFVLEDTWHYWFHRGLHYGVFYKYIHKQHHRYA APFGLAAEYAHPVEVALLGLGTVGIPIVWCLITGNLHLFTVSIWIILRLFQAVDAHSGYE FPWSLHNFLPFWAGADHHDEHHHYFIGGYSSSFRWWDFILDTEAGPKAKKGREDKVKQNV EKLQKKNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG25 |
Synonyms | ERG25; CAALFM_CR02370WA; CaO19.11216; CaO19.3732; Methylsterol monooxygenase; C-4 methylsterol oxidase |
UniProt ID | O59933 |
◆ Recombinant Proteins | ||
AMY2A-194C | Recombinant Cynomolgus AMY2A, Fc-tagged | +Inquiry |
MSRA-3453R | Recombinant Rat MSRA Protein, His (Fc)-Avi-tagged | +Inquiry |
F2R-458H | Recombinant Human F2R Full Length Transmembrane protein(VLPs) | +Inquiry |
MYH1B-5801C | Recombinant Chicken MYH1B | +Inquiry |
FKBP1B-2354R | Recombinant Rat FKBP1B Protein | +Inquiry |
◆ Native Proteins | ||
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
VCL tail-900T | Native Turkey VCL tail Protein | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
Collagen-58M | Native Mouse Collagen Type II | +Inquiry |
LH-12P | Native Porcine Luteinizing Hormone Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADM-1530HCL | Recombinant Human ADM cell lysate | +Inquiry |
FBXO34-604HCL | Recombinant Human FBXO34 cell lysate | +Inquiry |
ZNF133-143HCL | Recombinant Human ZNF133 293 Cell Lysate | +Inquiry |
TRIM47-1829HCL | Recombinant Human TRIM47 cell lysate | +Inquiry |
GOLGA5-727HCL | Recombinant Human GOLGA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERG25 Products
Required fields are marked with *
My Review for All ERG25 Products
Required fields are marked with *
0
Inquiry Basket