Recombinant Full Length Candida Albicans Golgi To Er Traffic Protein 2(Get2) Protein, His-Tagged
Cat.No. : | RFL21538CF |
Product Overview : | Recombinant Full Length Candida albicans Golgi to ER traffic protein 2(GET2) Protein (P0CB64) (1-298aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-298) |
Form : | Lyophilized powder |
AA Sequence : | MSEPVVDTAELSAEEKKRLLRERRQAKMSKGKATARLNDILSQGSSVKTSGVKSVLDQEK EATPSHDEDPEIQDITEITTPPPRTPPIGEDAPQDIDKIFQSMLQQQGQGADTAGDPFAQ IMKMFNQVEGGDSPPSESATSTQDPAELKYRQELLEYNTYNQKLWKFRFLLVRVSVTLFN FFYHYINLSNFHASNYAYVRDLSSEKYPVRDFFTWFATTEVVLVAAYYSIFHSLGLFHAA NQNSFVLKAMSMGSMVLPQLEHYKPLVARFLGYYELLGIVLGDLSLVIVLFGLLSFAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GET2 |
Synonyms | GET2; CAWG_00456; Golgi to ER traffic protein 2 |
UniProt ID | P0CB64 |
◆ Recombinant Proteins | ||
RFL12543MF | Recombinant Full Length Mouse Trace Amine-Associated Receptor 7A(Taar7A) Protein, His-Tagged | +Inquiry |
TNFSF4-2223H | Recombinant Human TNFSF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Il9-1059M | Recombinant Mouse Il9 Protein, His-tagged | +Inquiry |
RABL3-3585R | Recombinant Rhesus Macaque RABL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
OSCAR-12207M | Recombinant Mouse OSCAR Protein | +Inquiry |
◆ Native Proteins | ||
Lipoproteins-13H | Natve Human Lipoproteins, Very Low Density | +Inquiry |
Lectin-1848S | Active Native Soybean Agglutinin Protein | +Inquiry |
C1QA-26126TH | Native Human C1QA | +Inquiry |
MMP9-30035TH | Native Human MMP9 | +Inquiry |
UBA52-140H | Native Bovine Ubiquitin, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYROBP-614HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
CDPF1-8088HCL | Recombinant Human C22orf40 293 Cell Lysate | +Inquiry |
CD226-1167CCL | Recombinant Cynomolgus CD226 cell lysate | +Inquiry |
EAF1-6739HCL | Recombinant Human EAF1 293 Cell Lysate | +Inquiry |
CCDC103-7793HCL | Recombinant Human CCDC103 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GET2 Products
Required fields are marked with *
My Review for All GET2 Products
Required fields are marked with *
0
Inquiry Basket