Recombinant Full Length Candida Albicans Dihydroorotate Dehydrogenase (Quinone), Mitochondrial(Ura9) Protein, His-Tagged
Cat.No. : | RFL24429CF |
Product Overview : | Recombinant Full Length Candida albicans Dihydroorotate dehydrogenase (quinone), mitochondrial(URA9) Protein (Q874I4) (28-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (28-444) |
Form : | Lyophilized powder |
AA Sequence : | PLRSSFVPSPIVFVAGLAVAAVGGYYCLDSRSAIHEYVLCPLIRTFTDAESGHKLGIFFM KYGLSPRLLDDGKNDQSDVLGVQVFGHKLKNPIGLAAGLDKDGEAIESLFNCGFSYVEIG SITPEPQPGNPQPRFFRLPKDDAVINRYGFNSSGHFNVLATLKLRFNKLLNKFGTSHSSE QHPFSNAFQQGKLLGINLGKNKFGDEVNDYVKGVERLGPYADVLVINVSSPNTPGLRDLQ SEAKLTNLLTTVVKERNVLGKNLLGNKPPVLVKVAPDLTEPEIESIANSAKEAKVDGIII SNTTIQRPVDRLLTTDKQLINQAGGLSGKPLKPLSLKALRTLRKYTKDSDLVLIGCGGIS NGKDALEFGKAGATFIELYTAFAYKGPGLVGKIRDELAEELRKEGKTWEQIIGSDDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | URA9 |
Synonyms | URA9; URA1; CAALFM_C109720WA; CaO19.12299; CaO19.4836; Dihydroorotate dehydrogenase; quinone, mitochondrial; DHOD; DHODase; DHOdehase; Dihydroorotate oxidase |
UniProt ID | Q874I4 |
◆ Recombinant Proteins | ||
STAMBPL1-3133H | Recombinant Human STAMBPL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL36673SF | Recombinant Full Length Saccharomyces Cerevisiae Protein Transport Protein Yip1(Yip1) Protein, His-Tagged | +Inquiry |
C19orf70-3896H | Recombinant Human C19orf70 protein, His-tagged | +Inquiry |
PRPF31-10798Z | Recombinant Zebrafish PRPF31 | +Inquiry |
TRIM26-3662H | Recombinant Human TRIM26 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PLAU -15H | Native Human HMW urokinase, HRP conjugate | +Inquiry |
MB-30275TH | Native Human MB | +Inquiry |
Immunoglobulin E-80H | Native Human Immunoglobulin E | +Inquiry |
DES-167C | Native chicken DES | +Inquiry |
Laminin-32H | Native Human Laminin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF383-2020HCL | Recombinant Human ZNF383 cell lysate | +Inquiry |
PSMA7-2776HCL | Recombinant Human PSMA7 293 Cell Lysate | +Inquiry |
HA-2262ICL | Recombinant Influenza B HA cell lysate | +Inquiry |
Fetal Liver-148H | Human Fetal Liver Membrane Lysate | +Inquiry |
TAPBPL-1253HCL | Recombinant Human TAPBPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All URA9 Products
Required fields are marked with *
My Review for All URA9 Products
Required fields are marked with *
0
Inquiry Basket