Recombinant Full Length Candida Albicans C-5 Sterol Desaturase(Erg3) Protein, His-Tagged
Cat.No. : | RFL27135CF |
Product Overview : | Recombinant Full Length Candida albicans C-5 sterol desaturase(ERG3) Protein (O93875) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MDIVLEICDYYLFDKVYADVFPKDGAVHEFLKPAIQSFSQIDFPSLPNLDSFDTNSTLIS SNNFNISNVNPATIPSYLFSKIASYQDKSEIYGLAPKFFPATDFINTSFLARSNIFRETL SLFIITTIFGWLLYFIVAYLSYVFVFDKKIFNHPRYLKNQMSLEIKRATTAIPVMVLLTI PFFLLELNGYSFLYLDINECTGGYKAILWQIPKFILFTDCGIYFLHRWLHWPSVYKVLHK PHHKWIVCTPFASHAFHPVDGFFQSLPYHLYPLLFPLHKVLYLFLFTFVNFWTVMIHDGS YWSNDPVVNGTACHTVHHLYFNYNYGQFTTLWDRLGNSYRRPDDSLFVKDVKAEEEKKIW KEQTRKMEEIRGEVEGKVDDREYVEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG3 |
Synonyms | ERG3; Delta(7-sterol 5(6-desaturase; C-5 sterol desaturase; Ergosterol Delta(5,6 desaturase; Sterol-C5-desaturase |
UniProt ID | O93875 |
◆ Recombinant Proteins | ||
SCO2-14770M | Recombinant Mouse SCO2 Protein | +Inquiry |
NLGN1-167H | Recombinant Human NLGN1 Protein | +Inquiry |
ELOVL5-10757Z | Recombinant Zebrafish ELOVL5 | +Inquiry |
TPM3-8979HFL | Recombinant Full Length Human TPM3, Flag-tagged | +Inquiry |
Sulf2-666M | Recombinant Mouse Sulf2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
INS-5435B | Native Bovine Insulin | +Inquiry |
Lectin-1764C | Active Native Succinylated Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
C4-12H | Active Native Human C4 protein | +Inquiry |
Proteasome 20S-37H | Native Human Proteasome 20S Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMA1-2780HCL | Recombinant Human PSMA1 293 Cell Lysate | +Inquiry |
WDR89-329HCL | Recombinant Human WDR89 293 Cell Lysate | +Inquiry |
C2orf76-8063HCL | Recombinant Human C2orf76 293 Cell Lysate | +Inquiry |
C19orf59-8199HCL | Recombinant Human C19orf59 293 Cell Lysate | +Inquiry |
WWP1-273HCL | Recombinant Human WWP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERG3 Products
Required fields are marked with *
My Review for All ERG3 Products
Required fields are marked with *
0
Inquiry Basket