Recombinant Full Length Burkholderia Sp. Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged
Cat.No. : | RFL31440BF |
Product Overview : | Recombinant Full Length Burkholderia sp. Lipoprotein signal peptidase(lspA) Protein (Q39DM7) (1-166aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia lata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-166) |
Form : | Lyophilized powder |
AA Sequence : | MAKTLSKPASGALAPWLGISLIVILFDQLSKIAILKTFVYGAQHELTSFFNLVLVYNRGA AFGFLSTAGGWQRWAFTALGIAATLVICFLLKRHGQQRLFSLSLAMILGGALGNVIDRLV YGHVIDFLDFHLGAWHFPAFNLADSAITVGAVLLIYDELRRVRGSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lspA |
Synonyms | lspA; Bcep18194_A5845; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II |
UniProt ID | Q39DM7 |
◆ Native Proteins | ||
Protein C-89H | Native Human Protein C | +Inquiry |
FSH-1565S | Active Native Sheep Stimulating Hormone | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
CSK-27872TH | Native Human CSK | +Inquiry |
Lectin-1869W | Active Native Wisteria Floribunda Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP2A2-8816HCL | Recombinant Human AP2A2 293 Cell Lysate | +Inquiry |
CLEC10A-1730MCL | Recombinant Mouse CLEC10A cell lysate | +Inquiry |
MCAM-2742HCL | Recombinant Human MCAM cell lysate | +Inquiry |
ZFYVE28-1981HCL | Recombinant Human ZFYVE28 cell lysate | +Inquiry |
TRAP1-811HCL | Recombinant Human TRAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lspA Products
Required fields are marked with *
My Review for All lspA Products
Required fields are marked with *
0
Inquiry Basket