Recombinant Full Length Burkholderia Pseudomallei Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged
Cat.No. : | RFL2525BF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Glycerol-3-phosphate acyltransferase(plsY) Protein (Q63WM5) (1-203aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia pseudomallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-203) |
Form : | Lyophilized powder |
AA Sequence : | MQILLATVAAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGATNVLRSGNKKAAILTLVGD AFKGWLAVWLVKRFGIGGEIGVALAAIAVFLGHLYPVFFRFQGGKGVATAAGVLLAVHPV LGLATALTWLIVAFFFRYSSLAALVAAVFAPIFDVFLFGTRDNPVAWAVLAMSVLLIWRH RSNISKLLAGEESRIGQKKKTGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | plsY |
Synonyms | plsY; BPSL0866; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase |
UniProt ID | Q63WM5 |
◆ Recombinant Proteins | ||
OLFR15-6348M | Recombinant Mouse OLFR15 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM125A-2626H | Recombinant Human FAM125A protein, His-tagged | +Inquiry |
RFL29916RF | Recombinant Full Length Rat P-Selectin(Selp) Protein, His-Tagged | +Inquiry |
Gpc2-5625M | Active Recombinant Mouse Glypican 2 (cerebroglycan), His-tagged | +Inquiry |
UHRF1-1289HFL | Recombinant Full Length Human UHRF1 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1752A | Active Native Aleuria Aurantia Lectin Protein, Biotinylated | +Inquiry |
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
PPBP-30279TH | Native Human PPBP | +Inquiry |
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACE2-3100HCL | Recombinant Human ACE2 cell lysate | +Inquiry |
Testis-656B | Bovine Testis Lysate, Total Protein | +Inquiry |
TLE1-1051HCL | Recombinant Human TLE1 293 Cell Lysate | +Inquiry |
SIGLEC10-1849HCL | Recombinant Human SIGLEC10 293 Cell Lysate | +Inquiry |
MAD2L1-4570HCL | Recombinant Human MAD2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All plsY Products
Required fields are marked with *
My Review for All plsY Products
Required fields are marked with *
0
Inquiry Basket