Recombinant Full Length Burkholderia Phytofirmans Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL32816PF |
Product Overview : | Recombinant Full Length Burkholderia phytofirmans Membrane protein insertase YidC(yidC) Protein (B2T7U1) (1-552aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paraburkholderia phytofirmans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-552) |
Form : | Lyophilized powder |
AA Sequence : | MDIKRTVLWVIFFMSAVMLFDNWQRDHGRPSMFFPSATPTKTVGSAAPGTTTPGTQPADL PATNAAAPGNAPAATQSQLVKFNTDVYSGEIDTRGGTLSKLSLVNKGDGKQPDLVITLFD RTANHTYLARTGLLGGDFPNHNDIYTPLPNQQHDLTGDEKSFQLSFESPVKGGVKVIKTY TFTRGSYVIGVDTKIQNVGTAPVTPSVYMELVRDDQPVETPRFSHTFIGPAVYTDQHHFQ KMTFGDIDKNKQDYATSADNGWIAMVQHYFASAWIPQQGVKRDIYVEKIDPALYRVGVKE PVPTIAPGQTVDVSARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIHSY VGNWGWSIVLLTLLIKAVFFPLSAASYKSMARMKAITPRMQALRERFKGDPQKMNSALME LYKTEKVNPFGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWILWIHDLSQQDPFFILPVL MAVSMFLQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQYYI TRMMGQTKAKAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; Bphyt_3986; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B2T7U1 |
◆ Recombinant Proteins | ||
HAPLN1-253H | Recombinant Human HAPLN1, His-tagged | +Inquiry |
RdRp-01C | Recombinant 2019-nCoV RdRp Protein, His-tagged | +Inquiry |
Pgp-1372M | Recombinant Mouse Pgp Protein, Myc/DDK-tagged | +Inquiry |
BMP7-3522H | Recombinant Human BMP7 protein, For Organoid Culture | +Inquiry |
SE0758-3339S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0758 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
MG-41H | Active Native Human MG | +Inquiry |
ACPP-29981TH | Native Human ACPP | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5R3-7141HCL | Recombinant Human CYB5R3 293 Cell Lysate | +Inquiry |
PRPSAP2-2818HCL | Recombinant Human PRPSAP2 293 Cell Lysate | +Inquiry |
SSSCA1-1455HCL | Recombinant Human SSSCA1 293 Cell Lysate | +Inquiry |
BAG3-56HCL | Recombinant Human BAG3 lysate | +Inquiry |
PTPRD-2678HCL | Recombinant Human PTPRD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket