Recombinant Full Length Burkholderia Mallei Translocator Protein Bipb(Bipb) Protein, His-Tagged
Cat.No. : | RFL9269BF |
Product Overview : | Recombinant Full Length Burkholderia mallei Translocator protein BipB(bipB) Protein (Q62B07) (1-620aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia Mallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-620) |
Form : | Lyophilized powder |
AA Sequence : | MSSGVQGGPAANANAYQTHPLRDAASALGTLSPQAYVDVVSAAQRNFLERMSQLASEQCD AQPAAHDARLDDRPALRAPQERDAPPLGASDTGSRASGAAKLTELLGVLMSVISASSLDE LKQRSDIWNQMSKAAQDNLSRLSDAFQRATDEAKAAADAAEQAAAAAKQAGADAKAADAA VDAAQKRYDDAVKQGLPDDRLQSLKAALEQARQQAGDAHGRADALQADATKKLDAASALA TQARACEQQVDDAVNQATQQYGASASLRTPQSPRLSGAAELTAVLGKLQELISSGNVKEL ESKQKLFTEMQAKREAELQKKSDEYQAQVKKAEEMQKTMGCIGKIVGWVITAVSFAAAAF TGGASLALAAVGLALAVGDEISRATTGVSFMDKLMQPVMDAILKPLMEMISSLITKALVA CGVDQQKAELAGAILGAVVTGVALVAAAFVGASAVKAVASKVIDAMAGQLTKLMDSAIGK MLVQLIEKFSEKSGLQALGSRTATAMTRMRRAIGVEAKEDGMLLANRFEKAGTVMNVGNQ VSQAAGGIVVGVERAKAMGLLADVKEAMYDIKLLGDLLKQAVDAFAEHNRVLAQLMQQMS DAGEMQTSTGKLILRNARAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bipB |
Synonyms | bipB; BMAA1531; Translocator protein BipB |
UniProt ID | Q62B07 |
◆ Recombinant Proteins | ||
BRD4-6275Z | Recombinant Zebrafish BRD4 | +Inquiry |
TRPA1-1156HFL | Recombinant Human TRPA1 protein, His&Flag-tagged | +Inquiry |
CD3D-1182C | Recombinant Cynomolgus CD3D protein, hFc-tagged | +Inquiry |
PADI4-0132H | Recombinant Human PADI4 Protein (Met1-Pro663), N-TwinStrep-tagged | +Inquiry |
RFL1474MF | Recombinant Full Length Macaca Mulatta (Rhesus Macaque) Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IBVQ0291-229I | Native Influenza (B/Qingdao/102/91) IBVQ0291 protein | +Inquiry |
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
ACTA1-157R | Native Rabbit skeletal muscle alpha Actin | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A23-1623HCL | Recombinant Human SLC25A23 cell lysate | +Inquiry |
RPL10L-1538HCL | Recombinant Human RPL10L cell lysate | +Inquiry |
C20orf141-8124HCL | Recombinant Human C20orf141 293 Cell Lysate | +Inquiry |
Prostate-404C | Cynomolgus monkey Prostate Lysate | +Inquiry |
C13orf15-8305HCL | Recombinant Human C13orf15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All bipB Products
Required fields are marked with *
My Review for All bipB Products
Required fields are marked with *
0
Inquiry Basket