Recombinant Full Length Burkholderia Cepacia Fusaric Acid Resistance Protein Fusc(Fusc) Protein, His-Tagged
Cat.No. : | RFL32392BF |
Product Overview : | Recombinant Full Length Burkholderia cepacia Fusaric acid resistance protein FusC(fusC) Protein (P24128) (1-346aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia cepacia |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-346) |
Form : | Lyophilized powder |
AA Sequence : | MSAMTRVSEVIIGIVSAGVVSALVFPRYTGEQMRTTVRKRFGSFVDYVASALSGQLDRAH IETIHTRFAYVVGFEAARSMAVFEDPDTRMRSGRLARLNSEFMSASSRFHALHQLMNRLH AAGAQAAIDAIEPYFREIAPLLTRNGEPVRTSIDAAHSAEQLLAWRDALPRRIRATRAEL ETQPDFPLLDFDTAAELLYRFITDLQEYAATYASLATATHERERWIERYEPRTNKTAATI AGIRTATVILALGWFWIETAWPSGVMLVLNAAATCALASSAPRPTAMAAQMGMGTALAVC TGFLLTFGIYPRIDGFVLLCAALAPLLAIGIYMSLKPKLAGYGGAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fusC |
Synonyms | fusC; Fusaric acid resistance protein FusC |
UniProt ID | P24128 |
◆ Native Proteins | ||
Lectin-1721P | Native Peanut Lectin | +Inquiry |
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
Urease-52J | Active Native Jack Bean Urease | +Inquiry |
LDL-333H | Native Human LDL Protein | +Inquiry |
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
◆ Cell & Tissue Lysates | ||
RELB-1493HCL | Recombinant Human RELB cell lysate | +Inquiry |
IMPA1-5214HCL | Recombinant Human IMPA1 293 Cell Lysate | +Inquiry |
LIMS3-4735HCL | Recombinant Human LIMS3 293 Cell Lysate | +Inquiry |
MORN5-4248HCL | Recombinant Human MORN5 293 Cell Lysate | +Inquiry |
RIMS3-2338HCL | Recombinant Human RIMS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fusC Products
Required fields are marked with *
My Review for All fusC Products
Required fields are marked with *
0
Inquiry Basket