Recombinant Full Length Buchnera Aphidicola Subsp. Schizaphis Graminum Uncharacterized Metalloprotease Busg_310(Busg_310) Protein, His-Tagged
Cat.No. : | RFL15467BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Schizaphis graminum Uncharacterized metalloprotease BUsg_310(BUsg_310) Protein (Q8K9M4) (1-415aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera Aphidicola Subsp. Schizaphis Graminum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-415) |
Form : | Lyophilized powder |
AA Sequence : | MQQIYKIIFLSFNQDFFYKTIKILINIILIVIFILLSSCNFLTDKKAFFLNKEFSQKEKE FKRLKEKKEYLKKHTIHKHIFSYGNTISIFLKKSGVKINDILKLIKIDKNLNNITIGQKI VCKVDNLGNLIKLKWYISKFQKKIYKRYKNTFKFIKYTYDSFLEKKSIYIKKNSNFFKSA YQSGLNKSEINSVIKAIEWQINFNKLHIGSKFNVIFLNQKTKNKKILLGVKLDNLDRKYF SIRAFNGKFYDSDGFNKSEELINFSFLKKYRISSPFNLRRVNPVTHRISRHLGIDLAMPQ GTPVIATSSGKIIKAQFNKIAGFYISLKNKNYYTTRYMHLKKILVKVGQKIKKGEKIALS GNTGRTTGPHLHYEIWINHRAINPIKAEYILSTQLTKSERIKYLKESKNILSKLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BUsg_310 |
Synonyms | BUsg_310; Uncharacterized metalloprotease BUsg_310 |
UniProt ID | Q8K9M4 |
◆ Recombinant Proteins | ||
ELMOD2-5143M | Recombinant Mouse ELMOD2 Protein | +Inquiry |
FAM228A-370H | Recombinant Human FAM228A Protein, His-tagged | +Inquiry |
UBE2F-255H | Recombinant Human UBE2F Protein, MYC/DDK-tagged | +Inquiry |
TBCE-9045M | Recombinant Mouse TBCE Protein, His (Fc)-Avi-tagged | +Inquiry |
FLG2-5918M | Recombinant Mouse FLG2 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1716U | Native Ulex europaeus Lectin, Biotin conjugated | +Inquiry |
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
FGG-26469TH | Native Human Fibrinogen protein | +Inquiry |
GPT-26879TH | Native Human GPT | +Inquiry |
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH5A1-60HCL | Recombinant Human ALDH5A1 cell lysate | +Inquiry |
Skeletal Muscle-432G | Guinea Pig Skeletal Muscle Lysate | +Inquiry |
PLEK-3119HCL | Recombinant Human PLEK 293 Cell Lysate | +Inquiry |
HA-1565HCL | Recombinant H12N1 HA cell lysate | +Inquiry |
DHFR-353HCL | Recombinant Human DHFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BUsg_310 Products
Required fields are marked with *
My Review for All BUsg_310 Products
Required fields are marked with *
0
Inquiry Basket