Recombinant Full Length Buchnera Aphidicola Subsp. Schizaphis Graminum Multidrug Resistance-Like Atp-Binding Protein Mdlb(Mdlb) Protein, His-Tagged
Cat.No. : | RFL36492BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Schizaphis graminum Multidrug resistance-like ATP-binding protein MdlB(mdlB) Protein (Q8K984) (1-580aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera Aphidicola Subsp. Schizaphis Graminum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-580) |
Form : | Lyophilized powder |
AA Sequence : | MDHLIQFWPILKRLIIYAIPWKKKIILAFFLLLSGATSEVLGPILISYFINNILSQHQLN FQLILIIIVIFIMLQILAVFFNYFQSILFNKIAVGIVNKLRNDVMKAALNQPISEFDSQP IGQMISKVTNDTEVIKELYDTVGPTFFRSITLIIIILFAMFTLEWHMAIITIFIIPLVII VMSIYQYYSTPLLRNVRYYVANINNKFNETINGMNVIQQFRQQTRFENNIKESSELHYLA RMKILKLDGFLLRPLLSLLSALVLCSFMFLFSYFSIGVYEVGVLYAFITYLGRLNEPLIS ITIQQSILQQAIVAGERIFSLIDSPKQKYGNNEEEIKSGKINIKNLSFKYKESGENILNN INIYIPSKSFVAFVGQTGSGKSTLANLLMGYYPIKHGKIYLDDKSINCISHDVLRKNILM VQQDPIVLADTFSSNITLGKKISEEKIWNVLKTVHLSSLVQSMPKGIYSILGEEGNNLSL GQKQLLAIARILVRNPKILILDEATANIDSGTEKLIQTTLSSIRAKTTLVVIAHRLSTVI EADMIVVLKKGKIVELGTHKQLLEKKGFYWKMYNFQLFNC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mdlB |
Synonyms | mdlB; BUsg_465; Multidrug resistance-like ATP-binding protein MdlB |
UniProt ID | Q8K984 |
◆ Native Proteins | ||
Adipose Tissue-001H | Human Adipose Tissue Lysate, Total Protein | +Inquiry |
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
CTSG-8070H | Native Human Neutrophil Cathepsin G Biotinylated | +Inquiry |
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
TF-01B | Native Bovine TF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAC3-1287HCL | Recombinant Human TAC3 293 Cell Lysate | +Inquiry |
CCL16-7730HCL | Recombinant Human CCL16 293 Cell Lysate | +Inquiry |
ZCCHC17-202HCL | Recombinant Human ZCCHC17 293 Cell Lysate | +Inquiry |
SEMA3B-1981HCL | Recombinant Human SEMA3B 293 Cell Lysate | +Inquiry |
ATP5O-8595HCL | Recombinant Human ATP5O 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mdlB Products
Required fields are marked with *
My Review for All mdlB Products
Required fields are marked with *
0
Inquiry Basket