Recombinant Full Length Buchnera Aphidicola Subsp. Acyrthosiphon Pisum Protein Hflk(Hflk) Protein, His-Tagged
Cat.No. : | RFL13152BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Acyrthosiphon pisum Protein HflK(hflK) Protein (P57631) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera aphidicola subsp. Acyrthosiphon pisum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MVWNKPNNNKPDFDPWGNKDSKSKNCSDNKHEKKTTVLDIKNFLYNLKNIITKKTDSSNS SKKITYPFSIIIFISFFIWGVSGFYTITEAERGVVTSFGKFSHLVQPGLNWRPVFFNEVK PVNVETVRELATSGIMLTADENVVRVEMNVQYKITNPADYLFSVCYPDDSLRQATDSALR GVIGHSTMDRVLTEGRTLVRSDTQKEIENTIKPYKMGITILDVNFQTARPPEEVKAAFDD AIAARENREQYVREAEAYSNEVKPKANGKAQRILEEAKSYSSRIILQAQGEVARFSKILP EYRIAKKITLKRLYIESMERLLRKNKKIFIDTNNNPMFFFSLDNFFSKIKIPNKNFKDHI KINKNHSPFNKKVKNTNYFPFLSPDNISEQRRINSIRSDLKKIGRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hflK |
Synonyms | hflK; BU568; Protein HflK |
UniProt ID | P57631 |
◆ Recombinant Proteins | ||
PAX1-6515M | Recombinant Mouse PAX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMOD4-1900H | Recombinant Human TMOD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC9A3R1-8430M | Recombinant Mouse SLC9A3R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBR4-473R | Recombinant Rhesus Macaque CBR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUP62L-6332Z | Recombinant Zebrafish NUP62L | +Inquiry |
◆ Native Proteins | ||
ADVag-271V | Active Native ADV(Type 6, strain Tonsil 99) Protein | +Inquiry |
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
Thrombin-20H | Active Native Pig Thrombin | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
Factor D-61H | Native Human Factor D | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOM-1594HCL | Recombinant Human APOM cell lysate | +Inquiry |
PPPDE2-2906HCL | Recombinant Human PPPDE2 293 Cell Lysate | +Inquiry |
NGFRAP1-1191HCL | Recombinant Human NGFRAP1 cell lysate | +Inquiry |
YPEL2-240HCL | Recombinant Human YPEL2 293 Cell Lysate | +Inquiry |
MTFP1-1152HCL | Recombinant Human MTFP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hflK Products
Required fields are marked with *
My Review for All hflK Products
Required fields are marked with *
0
Inquiry Basket