Recombinant Full Length Brucella Suis Biovar 1 Beta-(1-->2)Glucan Export Atp-Binding/Permease Protein Ndva(Ndva) Protein, His-Tagged
Cat.No. : | RFL13522BF |
Product Overview : | Recombinant Full Length Brucella suis biovar 1 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA(ndvA) Protein (Q8G0T8) (1-599aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella suis biovar 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-599) |
Form : | Lyophilized powder |
AA Sequence : | MSLLKIYWRAMQYLAVERTATITMCVASVLVALVTLAEPVLFGRVIQSISDKGDIFSPLL MWAALGGFNIMAAVFVARGADRLAHRRRLGVMIDSYERLITMPLAWHQKRGTSNALHTLI RATDSLFTLWLEFMRQHLTTVVALATLIPVAMTMDMRMSLVLIVLGVIYVMIGQLVMRKT KDGQAAVEKHHHKLFEHVSDTISNVSVVQSYNRIASETQALRDYAKNLENAQFPVLNWWA LASGLNRMASTFSMVVVLVLGAYFVTKGQMRVGDVIAFIGFAQLMIGRLDQISAFINQTV TARAKLEEFFQMEDATADRQEPENVADLNDVKGDIVFDNVTFEFPNSGQGIYDVSFEVKP GQTVAIVGPTGAGKTTLINLLQRVFDPAAGRIMIDGTDTRTVSRRSLRHAIATVFQDAGL FNRSVEDNIRVGRANATHEEVHAAAKAAAAHDFILAKSEGYDTFVGERGSQLSGGERQRL AIARAILKDSPILVLDEATSALDVETEEKVKQAVDELSHNRTTFIIAHRLSTVRSADLVL FMDKGHLVESGSFNELAERGGRFSDLLRAGGLKLEDKQPKQPVVEGSNVMPFPVKGAVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndvA |
Synonyms | ndvA; BR0998; BS1330_I0994; Beta-(1-->2glucan export ATP-binding/permease protein NdvA |
UniProt ID | Q8G0T8 |
◆ Native Proteins | ||
Mucin-313 | Native Porcine Mucin Type III protein | +Inquiry |
Testosterone-01H | Native Human Testosterone | +Inquiry |
Hp-25 | Native Helicobacter pylori Antigen | +Inquiry |
FDP-E-50H | Native Human Fibrinogen Degrading Product-E | +Inquiry |
Heparin-200S | Active Native Swine Heparin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart-751B | Bovine Heart Membrane Lysate, Total Protein | +Inquiry |
TCEAL5-1190HCL | Recombinant Human TCEAL5 293 Cell Lysate | +Inquiry |
COQ10B-7349HCL | Recombinant Human COQ10B 293 Cell Lysate | +Inquiry |
KRT13-4881HCL | Recombinant Human KRT13 293 Cell Lysate | +Inquiry |
INPP5B-861HCL | Recombinant Human INPP5B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ndvA Products
Required fields are marked with *
My Review for All ndvA Products
Required fields are marked with *
0
Inquiry Basket