Recombinant Full Length Brucella Ovis Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged
Cat.No. : | RFL19539BF |
Product Overview : | Recombinant Full Length Brucella ovis NADH-quinone oxidoreductase subunit K(nuoK) Protein (A5VPZ3) (1-102aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella ovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-102) |
Form : | Lyophilized powder |
AA Sequence : | MEIGIAHYLTVSAILFTLGVFGIFLNRKNVIVILMSIELILLSVNLNFVAFSSQLGDLVG QVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nuoK |
Synonyms | nuoK; BOV_0807; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K |
UniProt ID | A5VPZ3 |
◆ Recombinant Proteins | ||
IL7RA-328H | Recombinant Human IL7RA protein, Fc-tagged | +Inquiry |
TNFSF8-68C | Active Recombinant Cynomolgus TNFSF8, His tagged | +Inquiry |
AP3M2-703R | Recombinant Rat AP3M2 Protein | +Inquiry |
RBM18-633H | Recombinant Human RNA binding motif protein 18, His-tagged | +Inquiry |
PTPRM-6108H | Recombinant Human PTPRM Protein (Thr1197-Ser1403), N-His tagged | +Inquiry |
◆ Native Proteins | ||
MDH-38P | Active Native Porcine Malate dehydrogenase | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
GG-190H | Native Horse Gamma Globulin protein | +Inquiry |
PLD-16C | Active Native cabbage Phospholipase D, Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK2A1-001MCL | Recombinant Mouse CSNK2A1 cell lysate | +Inquiry |
Colon-94R | Rhesus monkey Colon Membrane Lysate | +Inquiry |
FAIM-6466HCL | Recombinant Human FAIM 293 Cell Lysate | +Inquiry |
KLHL18-368HCL | Recombinant Human KLHL18 lysate | +Inquiry |
ZGPAT-169HCL | Recombinant Human ZGPAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nuoK Products
Required fields are marked with *
My Review for All nuoK Products
Required fields are marked with *
0
Inquiry Basket