Recombinant Full Length Brucella Melitensis Biotype 1 Putative Zinc Metalloprotease Bmei0829(Bmei0829) Protein, His-Tagged
Cat.No. : | RFL1800BF |
Product Overview : | Recombinant Full Length Brucella melitensis biotype 1 Putative zinc metalloprotease BMEI0829(BMEI0829) Protein (Q8YHH1) (1-379aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella melitensis biotype 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-379) |
Form : | Lyophilized powder |
AA Sequence : | MQEALALFFGSESLLVGTIIPFLFVLTVVVFVHEMGHYLVARWCGIGAQAFSIGFGPELL GFTDRHGTRWKLSAIPLVGYVKFIGDESETSSPVGVNESALSEEDRKRAFHTQPVWKRAA TVFAGPAFNIILTIAIFSVFFALYGRQIADPLIAGVQPGSPAAEAGFEPGDRFVSVEGEK ITTFADVQRIVSGRAGDKLNFTVERDGKMVDLQAVPKIVERTDPLGNKVKLGAIGVETTE AVGNFRRIEYGPLESVGQAVIETGHIIGRTGEFFKRFAVGREDKCQLGGPVKIATMASKA ASQGFDWLIQLMAMLSIGIGLLNLFPLPPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIG FLLVMGFMGFVLFNDLFAC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BMEI0829 |
Synonyms | BMEI0829; Putative zinc metalloprotease BMEI0829 |
UniProt ID | Q8YHH1 |
◆ Recombinant Proteins | ||
IVL-11H | Recombinant Human IVL Protein | +Inquiry |
IL9-8181M | Recombinant Mouse IL9 Protein | +Inquiry |
EHD4-1404R | Recombinant Rhesus monkey EHD4 Protein, His-tagged | +Inquiry |
SCYE1-2547H | Recombinant Human SCYE1, GST-tagged | +Inquiry |
TKTL1-1027C | Recombinant Cynomolgus TKTL1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ATP6AP2-27064TH | Native Human ATP6AP2 | +Inquiry |
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
Lectin-1762A | Active Native Agaricus bisporus lectin Protein, Biotinylated | +Inquiry |
SOD-45B | Active Native Bovine Superoxide dismutase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ileum-611R | Rat Ileum Lysate, Total Protein | +Inquiry |
FYCO1-6094HCL | Recombinant Human FYCO1 293 Cell Lysate | +Inquiry |
ME1-4401HCL | Recombinant Human ME1 293 Cell Lysate | +Inquiry |
TIGIT-2610HCL | Recombinant Human TIGIT cell lysate | +Inquiry |
PFN3-3266HCL | Recombinant Human PFN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMEI0829 Products
Required fields are marked with *
My Review for All BMEI0829 Products
Required fields are marked with *
0
Inquiry Basket